Overview

  • Product name

    Anti-Cytokeratin 14 antibody
    See all Cytokeratin 14 primary antibodies
  • Description

    Guinea pig polyclonal to Cytokeratin 14
  • Host species

    Guinea pig
  • Tested applications

    Suitable for: IHC-Fr, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Cow, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Cytokeratin 14 aa 1-472. (NP_000517.2)
    Sequence:

    MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGL SVSSSRFSSG GACGLGGGYGGGFSSSSSSFGSGFGGGYGGGLGAGLGG GFGGGFAGGDGLLVGSEKVTMQ NLNDRLASYLDKVRALEEANADLEVK IRDWYQRQRPAEIKDYSPYFKTIEDLRNKILTAT VDNANVLLQIDNAR LAADDFRTKYETELNLRMSVEADINGLRRVLDELTLARADLEMQIE SL KEELAYLKKNHEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYE KMAEKNRK DAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQN LEIELQSQLSMKASLENSLE ETKGRYCMQLAQIQEMIGSVEEQLAQLR CEMEQQNQEYKILLDVKTRLEQEIATYRRLLE GEDAHLSSSQFSSGSQ SSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN


    Database link: P02533

  • Positive control

    • Expressed in the basal cells of the larynx, esophagus, trachea, bladder, prostate, cervix, vagina, breast acini, skin and sweat glands.

Properties

Applications

Our Abpromise guarantee covers the use of ab192694 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr 1/100 - 1/200.
WB 1/5000 - 1/10000. Predicted molecular weight: 52 kDa.
IHC-P 1/50.

Target

  • Function

    The nonhelical tail domain is involved in promoting KRT5-KRT14 filaments to self-organize into large bundles and enhances the mechanical properties involved in resilience of keratin intermediate filaments in vitro.
  • Tissue specificity

    Detected in the basal layer, lowered within the more apically located layers specifically in the stratum spinosum, stratum granulosum but is not detected in stratum corneum. Strongly expressed in the outer root sheath of anagen follicles but not in the germinative matrix, inner root sheath or hair. Found in keratinocytes surrounding the club hair during telogen.
  • Involvement in disease

    Defects in KRT14 are a cause of epidermolysis bullosa simplex Dowling-Meara type (DM-EBS) [MIM:131760]. DM-EBS is a severe form of intraepidermal epidermolysis bullosa characterized by generalized herpetiform blistering, milia formation, dystrophic nails, and mucous membrane involvement.
    Defects in KRT14 are a cause of epidermolysis bullosa simplex Weber-Cockayne type (WC-EBS) [MIM:131800]. WC-EBS is a form of intraepidermal epidermolysis bullosa characterized by blistering limited to palmar and plantar areas of the skin.
    Defects in KRT14 are a cause of epidermolysis bullosa simplex Koebner type (K-EBS) [MIM:131900]. K-EBS is a form of intraepidermal epidermolysis bullosa characterized by generalized skin blistering. The phenotype is not fundamentally distinct from the Dowling-Meara type, although it is less severe.
    Defects in KRT14 are the cause of epidermolysis bullosa simplex autosomal recessive (AREBS) [MIM:601001]. AREBS is an intraepidermal epidermolysis bullosa characterized by localized blistering on the dorsal, lateral and plantar surfaces of the feet.
    Defects in KRT14 are the cause of Naegeli-Franceschetti-Jadassohn syndrome (NFJS) [MIM:161000]; also known as Naegeli syndrome. NFJS is a rare autosomal dominant form of ectodermal dysplasia. The cardinal features are absence of dermatoglyphics (fingerprints), reticular cutaneous hyperpigmentation (starting at about the age of 2 years without a preceding inflammatory stage), palmoplantar keratoderma, hypohidrosis with diminished sweat gland function and discomfort provoked by heat, nail dystrophy, and tooth enamel defects.
    Defects in KRT14 are the cause of dermatopathia pigmentosa reticularis (DPR) [MIM:125595]. DPR is a rare ectodermal dysplasia characterized by lifelong persistent reticulate hyperpigmentation, noncicatricial alopecia, and nail dystrophy.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Cellular localization

    Cytoplasm. Nucleus. Expressed in both as a filamentous pattern.
  • Information by UniProt
  • Database links

  • Alternative names

    • CK 14 antibody
    • CK-14 antibody
    • ck14 antibody
    • Cytokeratin 14 antibody
    • Cytokeratin-14 antibody
    • Cytokeratin14 antibody
    • Dowling Meara antibody
    • EBS3 antibody
    • EBS4 antibody
    • Epidermolysis bullosa simplex antibody
    • K14 antibody
    • K1C14_HUMAN antibody
    • Keratin 14 (epidermolysis bullosa simplex, Dowling-Meara, Koebner) antibody
    • Keratin 14 antibody
    • Keratin antibody
    • Keratin type I cytoskeletal 14 antibody
    • Keratin, type I cytoskeletal 14 antibody
    • Keratin-14 antibody
    • Keratin14 antibody
    • Koebner antibody
    • Krt 14 antibody
    • Krt14 antibody
    • NFJ antibody
    • OTTHUMP00000164624 antibody
    • type I cytoskeletal 14 antibody
    see all

References

This product has been referenced in:

  • Yeo AJ  et al. Increased susceptibility of airway epithelial cells from ataxia-telangiectasia to S. pneumoniae infection due to oxidative damage and impaired innate immunity. Sci Rep 9:2627 (2019). Read more (PubMed: 30796268) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192694.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up