Overview

  • Product name

    Anti-Cytokeratin 18 antibody [KRT18/1190]
    See all Cytokeratin 18 primary antibodies
  • Description

    Mouse monoclonal [KRT18/1190] to Cytokeratin 18
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Cytokeratin 18 aa 2-430.
    Sequence:

    SFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRS TSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSL ETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIV LQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLET EIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMAD IRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRR TVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQ TRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNS MQTIQKTTTRRIVDGKVVSETNDTKVLRH


    Database link: P05783

  • Positive control

    • IHC-P: Human prostate carcinoma and rat colon tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Primary incubation for 30 minutes at room temperature.

Target

  • Function

    Involved in the uptake of thrombin-antithrombin complexes by hepatic cells (By similarity). When phosphorylated, plays a role in filament reorganization. Involved in the delivery of mutated CFTR to the plasma membrane. Together with KRT8, is involved in interleukin-6 (IL-6)-mediated barrier protection.
  • Tissue specificity

    Expressed in colon, placenta, liver and very weakly in exocervix. Increased expression observed in lymph nodes of breast carcinoma.
  • Involvement in disease

    Defects in KRT18 are a cause of cirrhosis (CIRRH) [MIM:215600].
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Post-translational
    modifications

    Phosphorylation at Ser-34 increases during mitosis. Hyperphosphorylated at Ser-53 in diseased cirrhosis liver. Phosphorylation increases by IL-6.
    Proteolytically cleaved by caspases during epithelial cell apoptosis. Cleavage occurs at Asp-238 by either caspase-3, caspase-6 or caspase-7.
    O-glycosylated at multiple sites; glycans consist of single N-acetylglucosamine residues.
  • Cellular localization

    Cytoplasm > perinuclear region.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cell proliferation inducing gene 46 protein antibody
    • Cell proliferation inducing protein 46 antibody
    • Cell proliferation-inducing gene 46 protein antibody
    • CK 18 antibody
    • CK-18 antibody
    • CK18 antibody
    • CYK 18 antibody
    • CYK18 antibody
    • Cytokeratin 18 antibody
    • Cytokeratin endo B antibody
    • Cytokeratin-18 antibody
    • K 18 antibody
    • K18 antibody
    • K1C18_HUMAN antibody
    • KA18 antibody
    • Keratin 18 antibody
    • Keratin 18, type I antibody
    • Keratin D antibody
    • keratin, type I cytoskeletal 18 antibody
    • Keratin-18 antibody
    • Krt18 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat colon tissue stained for Cytokeratin 18 using ab233913 at 1 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human prostate carcinoma tissue stained for Cytokeratin 18 using ab233913 at 1 μg/ml in immunohistochemical analysis.

References

ab233913 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233913.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up