Overview

  • Product name

    Anti-Cytokeratin 19 antibody
    See all Cytokeratin 19 primary antibodies
  • Description

    Guinea pig polyclonal to Cytokeratin 19
  • Host species

    Guinea pig
  • Tested applications

    Suitable for: IHC-Fr, WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Cow, Human
    Predicted to work with: OrangutanDoes not react with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human Cytokeratin 19 aa 1-400. (Purified from MCF-7 cells).
    Sequence:

    MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSA RFVSSSSSGAYGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRA LEAANGELEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDKILGATIENSR IVLQIDNARLAADDFRTKFETEQALRMSVEADINGLRRVLDELTLARTDL EMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSAPGTDLAKILS DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLG DVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL


    Database link: P08727

Properties

Applications

Our Abpromise guarantee covers the use of ab192751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr 1/200.
WB 1/3000. Predicted molecular weight: 44 kDa.

(ECL method).

IHC-P 1/100.
ICC/IF 1/100.

Target

  • Function

    Involved in the organization of myofibers. Together with KRT8, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.
  • Tissue specificity

    Expressed in a defined zone of basal keratinocytes in the deep outer root sheath of hair follicles. Also observed in sweat gland and mammary gland ductal and secretory cells, bile ducts, gastrointestinal tract, bladder urothelium, oral epithelia, esophagus, ectocervical epithelium (at protein level). Expressed in epidermal basal cells, in nipple epidermis and a defined region of the hair follicle. Also seen in a subset of vascular wall cells in both the veins and artery of human umbilical cord, and in umbilical cord vascular smooth muscle. Observed in muscle fibers accumulating in the costameres of myoplasm at the sarcolemma in structures that contain dystrophin and spectrin.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Developmental stage

    Present in hair follicles at all stages of development.
  • Domain

    This keratin differs from all other IF proteins in lacking the C-terminal tail domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • 40 kDa keratin intermediate filament antibody
    • CK 19 antibody
    • CK-19 antibody
    • CK19 antibody
    • Cytokeratin 19 antibody
    • Cytokeratin-19 antibody
    • K19 antibody
    • K1C19_HUMAN antibody
    • K1CS antibody
    • Keratin 19 antibody
    • Keratin type I 40 kD antibody
    • Keratin type I 40kD antibody
    • Keratin type I cytoskeletal 19 antibody
    • Keratin, type I cytoskeletal 19 antibody
    • Keratin, type I, 40 kd antibody
    • Keratin-19 antibody
    • KRT19 antibody
    • MGC15366 antibody
    see all

References

ab192751 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Kidney)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Tris/EDTA buffer pH9 ab94681
Permeabilization
Yes - 0.05% Tween 20 in PBS
Specification
Kidney
Blocking step
Sea Block as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 22°C
Fixative
10%NBF

Mr. David Ivancic

Verified customer

Submitted May 21 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up