Overview

  • Product name

    Anti-Cytokeratin 2 antibody
    See all Cytokeratin 2 primary antibodies
  • Description

    Rabbit polyclonal to Cytokeratin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Cytokeratin 2 aa 173-283.
    Sequence:

    DPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWELLQQQT TGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFKKK YEDEINKRTAA


    Database link: Q01546

  • Positive control

    • WB: PC-3 whole cell lysate. IHC-P: Human endometrial cancer tissue. ICC/IF: SH-SY5Y cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
WB 1/500 - 1/5000. Predicted molecular weight: 66 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Probably contributes to terminal cornification.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Developmental stage

    Synthesized during maturation of epidermal keratinocytes.
  • Information by UniProt
  • Database links

  • Alternative names

    • CK 2P antibody
    • CK-2P antibody
    • CK2P antibody
    • Cytokeratin 2P antibody
    • Cytokeratin-2P antibody
    • Cytokeratin2 antibody
    • Cytokeratin2P antibody
    • HUMCYT 2A antibody
    • HUMCYT2A antibody
    • K22O_HUMAN antibody
    • K2P antibody
    • K76 antibody
    • KB9 antibody
    • Keratin 2p antibody
    • Keratin 76 antibody
    • Keratin 76, type II antibody
    • Keratin antibody
    • Keratin type II cytoskeletal 2 oral antibody
    • Keratin-76 antibody
    • Keratin2p antibody
    • Keratin76 antibody
    • KRT 2B antibody
    • KRT 2P antibody
    • KRT 76 antibody
    • KRT2B antibody
    • KRT2P antibody
    • KRT76 antibody
    • type II cytoskeletal 2 oral antibody
    • Type-II keratin Kb9 antibody
    see all

Images

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells labeling Cytokeratin 2 (green) with ab236751 at 1/133 dilution in ICC/IF. Counter-stained with DAPI.  The secondary antibody was Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L).

  • Anti-Cytokeratin 2 antibody (ab236751) at 1/500 dilution + PC-3 (human prostate adenocarcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 66 kDa

  • Paraffin-embedded human endometrial cancer tissue stained for Cytokeratin 2 using ab236751 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab236751 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236751.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up