Overview

  • Product name

    Anti-Cytokeratin 20 antibody
    See all Cytokeratin 20 primary antibodies
  • Description

    Rabbit polyclonal to Cytokeratin 20
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Human Cytokeratin 20 aa 9-424. Expressed in E.coli.
    Sequence:

    HRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSD LTGGGDLFVGNEKMAMQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYET NAPRAGRDYSAYYRQIEELRSQIKDAQLQNARCVLQIDNAKLAAEDFRLK YETERGIRLTVEADLQGLNKVFDDLTLHKTDLEIQIEELNKDLALLKKEH QEEVDGLHKHLGNTVNVEVDAAPGLNLGVIMNEMRQKYEVMAQKNLQEAK EQFERQTAVLQQQVTVNTEELKGTEVQLTELRRTSQSLEIELQSHLSMKE SLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLD IKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVV DGKVVSSEVKEVEENI


    Database link: P35900

  • Positive control

    • IHC-P: Human lung and stomach tissue. WB: Recombinant human Cytokeratin 20 protein; HeLa cell lysate; Pig intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 48 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Plays a significant role in maintaining keratin filament organization in intestinal epithelia. When phosphorylated, plays a role in the secretion of mucin in the small intestine.
  • Tissue specificity

    Expressed predominantly in the intestinal epithelium. Expressed in luminal cells of colonic mucosa. Also expressed in the Merkel cells of keratinized oral mucosa; specifically at the tips of some rete ridges of the gingival mucosa, in the basal layer of the palatal mucosa and in the taste buds of lingual mucosa.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Developmental stage

    First detected at embryonic week 8 in individual 'converted' simple epithelial cells of the developing intestinal mucosa. In later fetal stages, synthesis extends over most goblet cells and a variable number of villus enterocytes. In the developing gastric and intestinal mucosa, expressed in all enterocytes and goblet cells as well as certain 'low-differentiated' columnar cells, whereas the neuroendocrine and Paneth cells are negative.
  • Post-translational
    modifications

    Hyperphosphorylation at Ser-13 occurs during the early stages of apoptosis but becomes less prominent during the later stages. Phosphorylation at Ser-13 also increases in response to stress brought on by cell injury.
    Proteolytically cleaved by caspases during apoptosis. Cleavage occurs at Asp-228.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD20 antibody
    • CK 20 antibody
    • CK-20 antibody
    • CK20 antibody
    • Cytokeratin-20 antibody
    • Cytokeratin20 antibody
    • K1C20_HUMAN antibody
    • K20 antibody
    • KA20 antibody
    • Keratin 20 antibody
    • keratin 20, type I antibody
    • keratin 21, rat, homolog of antibody
    • Keratin antibody
    • Keratin type I cytoskeletal 20 antibody
    • Keratin-20 antibody
    • Keratin20 antibody
    • KRT 20 antibody
    • KRT 21 antibody
    • KRT20 antibody
    • KRT21 antibody
    • MGC35423 antibody
    • OTTHUMP00000164518 antibody
    • Protein IT antibody
    • type I cytoskeletal 20 antibody
    see all

Images

  • Anti-Cytokeratin 20 antibody (ab231954) at 2 µg/ml + Recombinant human Cytokeratin 20 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 48 kDa

  • All lanes : Anti-Cytokeratin 20 antibody (ab231954) at 2 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Pig intestine tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 48 kDa

  • Formalin-fixed, paraffin-embedded human lung tissue stained for Cytokeratin 20 using ab231954 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Cytokeratin 20 using ab231954 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up