Anti-Cytokeratin 2e antibody (ab231618)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Cytokeratin 2e antibody
See all Cytokeratin 2e primary antibodies -
Description
Rabbit polyclonal to Cytokeratin 2e -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat, Human
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment (His-tag) corresponding to Rat Cytokeratin 2e aa 368-507. (Expressed in E.coli).
Sequence:IAEVQSQYEIIAHKSKAESEELYHSKANEELQVTAVKHGDSLKEIKMEIS ELNRTIQRLQGEISHVKKQCKGVQDSIADAEQRGEHAIKDARGKLTDLEE ALQQGRENLARLLRDYQELMNVKLALDVEIATYRKLLEGE
Database link: Q6IG02 -
Positive control
- WB: Recombinant rat Cytokeratin 2e protein. IHC-P: Rat cerebrum and skin tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab231618 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab231618 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 5 - 20 µg/ml. | |
| WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 69 kDa. |
Target
-
Relevance
Keratins are the major gene product of keratinocytes and form the intermediate filament cytoskeletal network in these cells. In cells of the upper spinous layer, KRT2E and KRT9 are expressed. Although the expression of KRT9 is limited to palmoplantar epidermis, KRT2E is expressed not only in this tissue but also in other regions, notably the epidermis covering the knee, thigh, and groin. It is not known whether these keratins simply replace their respective type I or type II counterpart in the preexisting KRT1/KRT10 network or dimerize with another, as yet undiscovered keratin partner -
Cellular localization
Cytoplasmic -
Database links
- Entrez Gene: 3849 Human
- Entrez Gene: 16681 Mouse
- Entrez Gene: 406228 Rat
- Omim: 600194 Human
- SwissProt: P35908 Human
- SwissProt: Q3TTY5 Mouse
- SwissProt: Q6IG02 Rat
- Unigene: 707 Human
see all -
Alternative names
- CK 2e antibody
- Cytokeratin-2e antibody
- Epithelial keratin-2e antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytokeratin 2e antibody (ab231618)Formalin-fixed, paraffin-embedded rat skin tissue stained for Cytokeratin 2e using ab231618 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytokeratin 2e antibody (ab231618)Paraffin-embedded rat cerebrum tissue stained for Cytokeratin 2e using ab231618 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-Cytokeratin 2e antibody (ab231618)Anti-Cytokeratin 2e antibody (ab231618) at 2 µg/ml + Recombinant rat Cytokeratin 2e protein
Predicted band size: 69 kDa
Datasheets and documents
References
ab231618 has not yet been referenced specifically in any publications.
