Anti-Cytokeratin 2e antibody (ab231618)
Key features and details
- Rabbit polyclonal to Cytokeratin 2e
- Suitable for: IHC-P, WB
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-Cytokeratin 2e antibody
See all Cytokeratin 2e primary antibodies -
Description
Rabbit polyclonal to Cytokeratin 2e -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat, Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment (His-tag) corresponding to Rat Cytokeratin 2e aa 368-507. (Expressed in E.coli).
Sequence:IAEVQSQYEIIAHKSKAESEELYHSKANEELQVTAVKHGDSLKEIKMEIS ELNRTIQRLQGEISHVKKQCKGVQDSIADAEQRGEHAIKDARGKLTDLEE ALQQGRENLARLLRDYQELMNVKLALDVEIATYRKLLEGE
Database link: Q6IG02 -
Positive control
- WB: Recombinant rat Cytokeratin 2e protein. IHC-P: Rat cerebrum and skin tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab231618 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab231618 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 69 kDa. |
Target
-
Relevance
Keratins are the major gene product of keratinocytes and form the intermediate filament cytoskeletal network in these cells. In cells of the upper spinous layer, KRT2E and KRT9 are expressed. Although the expression of KRT9 is limited to palmoplantar epidermis, KRT2E is expressed not only in this tissue but also in other regions, notably the epidermis covering the knee, thigh, and groin. It is not known whether these keratins simply replace their respective type I or type II counterpart in the preexisting KRT1/KRT10 network or dimerize with another, as yet undiscovered keratin partner -
Cellular localization
Cytoplasmic -
Database links
- Entrez Gene: 3849 Human
- Entrez Gene: 16681 Mouse
- Entrez Gene: 406228 Rat
- Omim: 600194 Human
- SwissProt: P35908 Human
- SwissProt: Q3TTY5 Mouse
- SwissProt: Q6IG02 Rat
- Unigene: 707 Human
see all -
Alternative names
- CK 2e antibody
- Cytokeratin-2e antibody
- Epithelial keratin-2e antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytokeratin 2e antibody (ab231618)
Formalin-fixed, paraffin-embedded rat skin tissue stained for Cytokeratin 2e using ab231618 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytokeratin 2e antibody (ab231618)
Paraffin-embedded rat cerebrum tissue stained for Cytokeratin 2e using ab231618 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-Cytokeratin 2e antibody (ab231618) at 2 µg/ml + Recombinant rat Cytokeratin 2e protein
Predicted band size: 69 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231618 has not yet been referenced specifically in any publications.