Overview

  • Product name

    Anti-Cytokeratin 4 antibody
    See all Cytokeratin 4 primary antibodies
  • Description

    Rabbit polyclonal to Cytokeratin 4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human Cytokeratin 4 aa 203-248.
    Sequence:

    ETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKR


    Database link: P19013

  • Positive control

    • HEK293T, Raw264.7 and PC12 whole cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab200669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent dilution. Predicted molecular weight: 57 kDa.

Target

  • Tissue specificity

    Detected in the suprabasal layer of the stratified epithelium of the esophagus, exocervix, vagina, mouth and lingual mucosa, and in cells and cell clusters in the mucosa and serous gland ducts of the esophageal submucosa (at protein level). Expressed widely in the exocervix and esophageal epithelium, with lowest levels detected in the basal cell layer.
  • Involvement in disease

    Defects in KRT4 are a cause of white sponge nevus of cannon (WSN) [MIM:193900]. WSN is a rare autosomal dominant disorder which predominantly affects non-cornified stratified squamous epithelia. Clinically, it is characterized by the presence of soft, white, and spongy plaques in the oral mucosa. The characteristic histopathologic features are epithelial thickening, parakeratosis, and vacuolization of the suprabasal layer of oral epithelial keratinocytes. Less frequently the mucous membranes of the nose, esophagus, genitalia and rectum are involved.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Information by UniProt
  • Database links

  • Form

    Localisation: Intermediate filament (Cytoskeleton).
  • Alternative names

    • CK 4 antibody
    • CK-4 antibody
    • CK4 antibody
    • CYK4 antibody
    • Cytokeratin 4 antibody
    • Cytokeratin-4 antibody
    • Cytokeratin4 antibody
    • FLJ31692 antibody
    • K2C4_HUMAN antibody
    • K4 antibody
    • Keratin 4 antibody
    • Keratin antibody
    • Keratin type II cytoskeletal 4 antibody
    • Keratin-4 antibody
    • Keratin4 antibody
    • KRT 4 antibody
    • Krt4 antibody
    • type II cytoskeletal 4 antibody
    • Type-II keratin Kb4 antibody
    see all

Images

  • All lanes : Anti-Cytokeratin 4 antibody (ab200669)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : Raw264.7 whole cell lysate
    Lane 3 : PC12 whole cell lysate

    Predicted band size: 57 kDa

References

ab200669 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up