Overview

  • Product name

    Anti-Cytokeratin 6 antibody [KRT6/1702]
    See all Cytokeratin 6 primary antibodies
  • Description

    Mouse monoclonal [KRT6/1702] to Cytokeratin 6
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human Cytokeratin 6 aa 1-564.
    Sequence:

    MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGA CGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGF GFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNL QIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWTLLQE QGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELRGMQDLVEDFK NKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRA EAESWYQTKYEELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKK QCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQE LMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGGA SGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIK YTTTSSSSRKSYKH


    Database link: P02538

  • Positive control

    • IHC-P: Human bladder carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab218438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.1 - 0.2 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(for 30 minutes at RT)

Target

  • Tissue specificity

    Constitutively expressed in distinct types of epithelia such as those in oral mucosa, esophagus, papillae of tongue and hair follicle outer root sheath.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Information by UniProt
  • Database links

  • Alternative names

    • CK 6A antibody
    • CK 6B antibody
    • CK 6C antibody
    • CK 6D antibody
    • CK 6E antibody
    • CK-6B antibody
    • CK-6C antibody
    • CK-6E antibody
    • Cytokeratin 6a antibody
    • Cytokeratin 6B antibody
    • Cytokeratin 6C antibody
    • Cytokeratin 6D antibody
    • Cytokeratin 6E antibody
    • Cytokeratin-6B antibody
    • Cytokeratin-6C antibody
    • Cytokeratin-6E antibody
    • K2C6C_HUMAN antibody
    • K6a keratin antibody
    • K6b keratin antibody
    • K6C antibody
    • K6c keratin antibody
    • K6d keratin antibody
    • K6e keratin antibody
    • Keratin antibody
    • Keratin K6h antibody
    • Keratin type II cytoskeletal 6A antibody
    • Keratin type II cytoskeletal 6B antibody
    • Keratin type II cytoskeletal 6C antibody
    • Keratin type II cytoskeletal 6D antibody
    • Keratin type II cytoskeletal 6E antibody
    • Keratin-6C antibody
    • KRT6A antibody
    • KRT6B antibody
    • KRT6C antibody
    • KRT6D antibody
    • KRT6E antibody
    • type II cytoskeletal 6C antibody
    • Type-II keratin Kb12 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human bladder carcinoma tissue labeling Cytokeratin 6 with ab218438 at 0.2 µg/mL.

References

ab218438 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218438.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up