Overview

  • Product name

    Anti-Cytokeratin 7 antibody
    See all Cytokeratin 7 primary antibodies
  • Description

    Rabbit polyclonal to Cytokeratin 7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, IP, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant full length protein corresponding to Human Cytokeratin 7 aa 2-469.
    Sequence:

    SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV RSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNK FASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQ LEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDV DAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDN SRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDL RNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDAR AKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEES RLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGL LKAYSIRTASASRRSARD


    Database link: P08729

  • Positive control

    • WB: HeLa, HepG2 and A549 whole cell lysates. IP: HepG2 whole cell lysate. IHC-P: Human liver and cervical cancer tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    >95% pure
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
IP 1/200 - 1/2000.
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 52 kDa (predicted molecular weight: 51 kDa).

Target

  • Function

    Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
  • Tissue specificity

    Expressed in cultured epidermal, bronchial and mesothelial cells but absent in colon, ectocervix and liver. Observed throughout the glandular cells in the junction between stomach and esophagus but is absent in the esophagus.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Post-translational
    modifications

    Arg-20 is dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CK 7 antibody
    • CK-7 antibody
    • CK7 antibody
    • Cytokeratin 7 antibody
    • Cytokeratin-7 antibody
    • D15Wsu77e antibody
    • K2C7 antibody
    • K2C7_HUMAN antibody
    • K7 antibody
    • Keratin 7 antibody
    • Keratin 7, type II antibody
    • Keratin type II cytoskeletal 7 antibody
    • Keratin, 55K type II cytoskeletal antibody
    • Keratin, simple epithelial antibody
    • Keratin, simple epithelial type I, K7 antibody
    • Keratin, type II cytoskeletal 7 antibody
    • Keratin-7 antibody
    • Krt2-7 antibody
    • KRT7 antibody
    • MGC11625 antibody
    • MGC129731 antibody
    • MGC3625 antibody
    • Sarcolectin antibody
    • SCL antibody
    • Type II mesothelial keratin K7 antibody
    • Type-II keratin Kb7 antibody
    see all

Images

  • Paraffin embedded sections of human liver tissue were stained for Cytokeratin 7 with ab223051 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin embedded sections of human cervical cancer tissue were stained for Cytokeratin 7 with ab223051 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Cytokeratin 7 (green) using ab223051 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-congugated AffiniPure Goat Anti-Rabbit IgG (H+L).

  • All lanes : Anti-Cytokeratin 7 antibody (ab223051) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat Anti_rabbit IgG at 1/50000 dilution

    Predicted band size: 51 kDa
    Observed band size: 52 kDa
    why is the actual band size different from the predicted?

  • Cytokeratin 7 was immunoprecipitated from 0.5 mg HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate with ab223051 at 1/200 dilution. Western blot was performed from the immunoprecipitate using ab223051 at 1/500 dilution.  HRP-conjugated Protein G was used as the secondary at 1/200 dilution.
    Lane 1: Control IP with Rabbit monoclonal IgG
    Lane 2: ab223051 IP in HepG2 whole cell lysate.
    Lane 3: HepG2 whole cell lysate 10 μg (Input).

References

ab223051 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up