Overview

  • Product name

    Anti-Cytokeratin 7 antibody [KRT7/760] - BSA and Azide free
    See all Cytokeratin 7 primary antibodies
  • Description

    Mouse monoclonal [KRT7/760] to Cytokeratin 7 - BSA and Azide free
  • Host species

    Mouse
  • Specificity

    ab215855 is highly specific to the interfilament protein (IFP) Cytokeratin 7 and shows no cross reaction with other IFPs.
  • Tested applications

    Suitable for: IHC-P, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant full length protein corresponding to Human Cytokeratin 7 aa 1-469.
    Sequence:

    MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVA VRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNN KFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRG QLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKD VDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMD NSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDD LRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDA RAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEE SRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPG LLKAYSIRTASASRRSARD


    Database link: P08729

  • Positive control

    • IHC-P: Human ovarian, lung and endometrial carcinoma.

Properties

Applications

Our Abpromise guarantee covers the use of ab215855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt Use 0.5-1µg for 106 cells.

in 0.1ml

ICC/IF Use a concentration of 0.5 - 1 µg/ml.

Target

  • Function

    Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
  • Tissue specificity

    Expressed in cultured epidermal, bronchial and mesothelial cells but absent in colon, ectocervix and liver. Observed throughout the glandular cells in the junction between stomach and esophagus but is absent in the esophagus.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Post-translational
    modifications

    Arg-20 is dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CK 7 antibody
    • CK-7 antibody
    • CK7 antibody
    • Cytokeratin 7 antibody
    • Cytokeratin-7 antibody
    • D15Wsu77e antibody
    • K2C7 antibody
    • K2C7_HUMAN antibody
    • K7 antibody
    • Keratin 7 antibody
    • Keratin 7, type II antibody
    • Keratin type II cytoskeletal 7 antibody
    • Keratin, 55K type II cytoskeletal antibody
    • Keratin, simple epithelial antibody
    • Keratin, simple epithelial type I, K7 antibody
    • Keratin, type II cytoskeletal 7 antibody
    • Keratin-7 antibody
    • Krt2-7 antibody
    • KRT7 antibody
    • MGC11625 antibody
    • MGC129731 antibody
    • MGC3625 antibody
    • Sarcolectin antibody
    • SCL antibody
    • Type II mesothelial keratin K7 antibody
    • Type-II keratin Kb7 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human endometrial carcinoma tissue labeling Cytokeratin 7 with ab215855 at 0.5 µg/mL.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung carcinoma tissue labeling Cytokeratin 7 with ab215855 at 0.5 µg/mL.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human ovarian carcinoma tissue labeling Cytokeratin 7 with ab215855 at 0.5 µg/mL.

References

ab215855 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215855.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up