Overview

  • Product name

    Anti-Cytokeratin 7 antibody [KRT7/903] - BSA and Azide free
    See all Cytokeratin 7 primary antibodies
  • Description

    Mouse monoclonal [KRT7/903] to Cytokeratin 7 - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Does not react with: Mouse, Rat, Rabbit, Ferret
  • Immunogen

    Recombinant full length protein corresponding to Human Cytokeratin 7 aa 1-469.
    Sequence:

    MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVA VRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNN KFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRG QLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKD VDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMD NSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDD LRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDA RAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEE SRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPG LLKAYSIRTASASRRSARD


    Database link: P08729

  • Positive control

    • A431 and HeLa cells Human breast cancer tissue; Human ovarian carcinoma tissue

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from bioreactor concentrate.
  • Clonality

    Monoclonal
  • Clone number

    KRT7/903
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab212528 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use 0.5-1µg for 106 cells.

Final volume 100 µL.

ICC/IF Use a concentration of 0.5 - 1 µg/ml.
IHC-P Use a concentration of 1 - 2 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Target

  • Function

    Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
  • Tissue specificity

    Expressed in cultured epidermal, bronchial and mesothelial cells but absent in colon, ectocervix and liver. Observed throughout the glandular cells in the junction between stomach and esophagus but is absent in the esophagus.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Post-translational
    modifications

    Arg-20 is dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CK 7 antibody
    • CK-7 antibody
    • CK7 antibody
    • Cytokeratin 7 antibody
    • Cytokeratin-7 antibody
    • D15Wsu77e antibody
    • K2C7 antibody
    • K2C7_HUMAN antibody
    • K7 antibody
    • Keratin 7 antibody
    • Keratin 7, type II antibody
    • Keratin type II cytoskeletal 7 antibody
    • Keratin, 55K type II cytoskeletal antibody
    • Keratin, simple epithelial antibody
    • Keratin, simple epithelial type I, K7 antibody
    • Keratin, type II cytoskeletal 7 antibody
    • Keratin-7 antibody
    • Krt2-7 antibody
    • KRT7 antibody
    • MGC11625 antibody
    • MGC129731 antibody
    • MGC3625 antibody
    • Sarcolectin antibody
    • SCL antibody
    • Type II mesothelial keratin K7 antibody
    • Type-II keratin Kb7 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded human ovarian carcinoma tissue labeling Cytokeratin 7 with ab212528 at 1 µg/mL.

References

ab212528 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212528.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up