Overview

  • Product name
    Anti-Cytokeratin 8 antibody
    See all Cytokeratin 8 primary antibodies
  • Description
    Rabbit polyclonal to Cytokeratin 8
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human Cytokeratin 8 aa 1-483.
    Sequence:

    MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL GGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNN KFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQ LETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDV DEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDN SRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDL RRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDAN AKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEES RLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSS SFSRTSSSRAVVVKKIETRDGKLVSESSDV LPK


    Database link: P05787

  • Positive control
    • 293T, HeLa, DU145 and NIH3T3 cell line lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab175249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 66 kDa.

Target

  • Function
    Together with KRT19, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.
  • Tissue specificity
    Observed in muscle fibers accumulating in the costameres of myoplasm at the sarcolemma membrane in structures that contain dystrophin and spectrin. Expressed in gingival mucosa and hard palate of the oral cavity.
  • Involvement in disease
    Cirrhosis
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Post-translational
    modifications
    Phosphorylation on serine residues is enhanced during EGF stimulation and mitosis. Ser-74 phosphorylation plays an important role in keratin filament reorganization.
    O-glycosylated. O-GlcNAcylation at multiple sites increases solubility, and decreases stability by inducing proteasomal degradation.
    O-glycosylated (O-GlcNAcylated), in a cell cycle-dependent manner.
  • Cellular localization
    Cytoplasm. Nucleus, nucleoplasm. Nucleus matrix.
  • Information by UniProt
  • Database links
  • Alternative names
    • CARD2 antibody
    • CK 8 antibody
    • CK-8 antibody
    • CK8 antibody
    • CYK8 antibody
    • CYKER antibody
    • Cytokeratin endo A antibody
    • Cytokeratin-8 antibody
    • DreK8 antibody
    • EndoA antibody
    • K2C8 antibody
    • K2C8_HUMAN antibody
    • K8 antibody
    • Keratin 8 antibody
    • Keratin type II cytoskeletal 8 antibody
    • Keratin, type II cytoskeletal 8 antibody
    • Keratin-8 antibody
    • KO antibody
    • Krt 2.8 antibody
    • KRT8 antibody
    • MGC118110 antibody
    • MGC174782 antibody
    • MGC53564 antibody
    • MGC85764 antibody
    • sb:cb186 antibody
    • Type-II keratin Kb8 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung cancer tissue labelling Cytokeratin 8 with ab175249 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human breast cancer tissue labelling Cytokeratin 8 with ab175249 at 1/200. Magnification: 400x.
  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175249. Blue DAPI for nuclear staining.
  • All lanes : Anti-Cytokeratin 8 antibody (ab175249) at 1/500 dilution

    Lane 1 : 293T cell line lysate
    Lane 2 : HeLa cell line lysate
    Lane 3 : DU145 cell line lysate
    Lane 4 : NIH3T3 cell line lysate

    Predicted band size: 66 kDa

References

ab175249 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up