Overview

  • Product name

    Anti-Cytosolic Phospholipase A2 antibody [C1]
    See all Cytosolic Phospholipase A2 primary antibodies
  • Description

    Mouse monoclonal [C1] to Cytosolic Phospholipase A2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Cytosolic Phospholipase A2 aa 563-749. N-Terminal His-tag. Expressed in E.coli
    Sequence:

    RPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMNKLPFPKIDPYVF DREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYRAPGVPRETEEE KEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAM VESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSKPKA


    Database link: P47712

  • Positive control

    • WB: Recombinant human Cytosolic Phospholipase A2 protein; human lung lysate; PC3 and HeLa cell lysates. IHC-P: Human kidney, pancreas, glioma and stomach tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab239730 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 85 kDa.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

Images

  • Paraffin-embedded human glioma tissue stained for Cytosolic Phospholipase A2 using ab239730 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-Cytosolic Phospholipase A2 antibody [C1] (ab239730) at 1 µg/ml

    Lane 1 : Human lung lysate
    Lane 2 : PC-3 (human prostate adenocarcinoma cell line) cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    All lanes : HRP-Linked Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 85 kDa

  • Paraffin-embedded human kidney tissue stained for Cytosolic Phospholipase A2 using ab239730 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Cytosolic Phospholipase A2 antibody [C1] (ab239730) at 5 µg/ml + Recombinant human Cytosolic Phospholipase A2 protein

    Predicted band size: 85 kDa

  • Paraffin-embedded human pancreas tissue stained for Cytosolic Phospholipase A2 using ab239730 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach tissue stained for Cytosolic Phospholipase A2 using ab239730 at 30 μg/ml in immunohistochemical analysis. DAB staining.

References

ab239730 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239730.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up