Overview

  • Product name

  • Description

    Rabbit polyclonal to D4 GDI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human D4 GDI aa 2-86.
    Sequence:

    TEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKT LLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMD


    Database link: P52566

  • Positive control

    • WB: Jurkat, Raji and THP-1 whole cell lysates. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 22 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them (PubMed:8356058, PubMed:7512369). Regulates reorganization of the actin cytoskeleton mediated by Rho family members (PubMed:8262133).
  • Tissue specificity

    Detected in bone marrow, thymus and spleen.
  • Sequence similarities

    Belongs to the Rho GDI family.
  • Cellular localization

    Cytoplasm, cytosol.
  • Information by UniProt
  • Database links

  • Alternative names

    • Arhgdib antibody
    • D4 antibody
    • D4 GDP dissociation inhibitor antibody
    • GDIA 2 antibody
    • GDIA2 antibody
    • GDID 4 antibody
    • GDID4 antibody
    • GDIR2_HUMAN antibody
    • GDP dissociation inhibitor D4 antibody
    • LY GDI antibody
    • Ly-GDI antibody
    • LYGDI antibody
    • MGC108926 antibody
    • RAP1GN1 antibody
    • Rho GDI 2 antibody
    • Rho GDI beta antibody
    • Rho GDI2 antibody
    • Rho GDP dissociation inhibitor (GDI) beta antibody
    • Rho GDP dissociation inhibitor 2 antibody
    • Rho GDP dissociation inhibitor beta antibody
    • Rho GDP-dissociation inhibitor 2 antibody
    • Rho-GDI beta antibody
    • RhoGDI2 antibody
    see all

Images

  • All lanes : Anti-D4 GDI antibody (ab236593) at 1/2000 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : Raji (human Burkitt's lymphoma cell line) whole cell lysate
    Lane 3 : THP-1 (human monocytic leukemia cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 22 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for D4 GDI (green) using ab236593 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236593 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up