Overview

  • Product name

  • Description

    Rabbit polyclonal to DAAM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human DAAM1 aa 2-59.
    Sequence:

    APRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVE ELDVMFSE


    Database link: Q9Y4D1

  • Positive control

    • ICC/IF: HaCaT cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221571 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    DAAM1 (Dishevelled associated activator of morphogenesis 1) is a diaphanous-related formin which binds to dishevelled (Dvl) and Rho, and mediates Wnt-induced Dvl-Rho complex assembly. It is an essential component of noncanonical Wnt signaling. DAAM1 also communicates with Rho GTPases, CIP4 and Src in the regulation of the signalling pathways that co-ordinate the dynamics of the actin filament system. DAAM1 may be a coordinator of endocytosis and cytoskeletal remodeling.
  • Cellular localization

    Cytoplasmic. Note: Perinuclear.
  • Database links

  • Alternative names

    • DAAM 1 antibody
    • Dishevelled associated activator of morphogenesis 1 antibody
    • FLJ41657 antibody
    • KIAA0666 antibody

Images

  • PFA-fixed, Triton X-100 permeabilized HaCaT (human keratinocyte cell line) cells stained for DAAM1 (green) using ab221571 at 4 µg/ml in ICC/IF. 

References

ab221571 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221571.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up