Overview

  • Product name

  • Description

    Rabbit polyclonal to DAAM2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DAAM2 aa 1-101.
    Sequence:

    MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNI RFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKKEQEDPNKLATSWPD Y


    Database link: Q86T65

  • Positive control

    • IHC: Human colon cancer and melanoma cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222853 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Expressed in most tissues examined.
  • Sequence similarities

    Belongs to the formin homology family.
    Contains 1 DAD (diaphanous autoregulatory) domain.
    Contains 1 FH1 (formin homology 1) domain.
    Contains 1 FH2 (formin homology 2) domain.
    Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • DAAM2 antibody
    • DAAM2_HUMAN antibody
    • Disheveled-associated activator of morphogenesis 2 antibody
    • dishevelled associated activator of morphogenesis 2 antibody
    • dJ90A20A.1 antibody
    • KIAA0381 antibody
    • MGC90515 antibody
    • RP1 278E11.1 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for DAAM2 using ab222853 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human melanoma cancer tissue stained for DAAM2 using ab222853 at 1/100 dilution in immunohistochemical analysis.

References

ab222853 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222853.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up