Overview

  • Product name

  • Description

    Rabbit polyclonal to Dab1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human Dab1 aa 191-240. The exact sequence is proprietary.
    Sequence:

    EDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPV


    Database link: O75553

  • Positive control

    • HeLa and H9C2 cell lysates; Human small intestine and brain cerebellum tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab192823 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/1000. Predicted molecular weight: 64 kDa.
IHC-P Use a concentration of 10 µg/ml.

Target

  • Function

    Adapter molecule functioning in neural development. May regulate SIAH1 activity.
  • Sequence similarities

    Contains 1 PID domain.
  • Domain

    The PID domain specifically binds to the Asn-Pro-Xaa-Tyr(P) motif found in many tyrosine-phosphorylated proteins.
  • Post-translational
    modifications

    Phosphorylated on Tyr-198 and Tyr-220 upon reelin induction in embryonic neurons (By similarity). Also phosphorylated on Ser-524 independently of reelin signaling.
  • Information by UniProt
  • Database links

  • Alternative names

    • Dab 1 antibody
    • Dab reelin signal transducer 1 antibody
    • Dab, reelin signal transducer, homolog 1 (Drosophila) antibody
    • Dab1 antibody
    • DAB1_HUMAN antibody
    • Disabled homolog 1 antibody
    • Disabled homolog 1 Drosophila antibody
    • Scm antibody
    • Scr antibody
    • Scrambler antibody
    • Yot antibody
    • Yotari antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human small intestine tissue labeling Dab1 with ab192823 at 10 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human brain cerebellum tissue labeling Dab1 with ab192823 at 10 µg/ml.

  • All lanes : Anti-Dab1 antibody (ab192823) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : H9C2 cell lysate

    Predicted band size: 64 kDa

References

ab192823 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192823.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up