Overview

  • Product name

  • Description

    Rabbit polyclonal to DACH1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human DACH1 aa 166-369.
    Sequence:

    CGPLPGKPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCELICLPQ AFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNR CKLISRKDFETLYNDCTNASSRPGRPPKRTQSVTSPENSHIMPHSVPGLM SPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNNQHG ADSE


    Database link: Q9UI36

  • Positive control

    • IHC-P: Human kidney tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Transcription factor that is involved in regulation of organogenesis. Seems to be a regulator of SIX1, SIX6 and probably SIX5. Corepression of precursor cell proliferation in myoblasts by SIX1 is switched to coactivation through recruitment of EYA3 to the SIX1-DACH1 complex. Transcriptional activation seems also to involve association of CREBBP. Seems to act as a corepressor of SIX6 in regulating proliferation by directly repressing cyclin-dependent kinase inhibitors, including the p27Kip1 promoter (By similarity). Inhibits TGF-beta signaling through interaction with SMAD4 and NCOR1. Binds to chromatin DNA via its DACHbox-N domain.
  • Tissue specificity

    Widely expressed. Isoform 2 is found in brain, heart, kidney, liver, leukocytes and spleen. Isoform 3 is found in liver and heart. Isoform 4 is found in spleen.
  • Sequence similarities

    Belongs to the DACH/dachshund family.
  • Domain

    The DACHbox-N/DD1 domain forms a structure containing a DNA binding motif similar to that of the forkhead/winged helix domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DACH antibody
    • Dach1 antibody
    • DACH1_HUMAN antibody
    • Dachshund family transcription factor 1 antibody
    • dachshund homolog 1 (Drosophila) antibody
    • Dachshund homolog 1 antibody
    • Dachsund homolog 1 antibody
    • FLJ10138 antibody
    • OTTHUMP00000018494 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for DACH1 using ab222832 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for DACH1 (green) using ab222832 at 1/100 dilution in ICC/IF.

References

ab222832 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up