Overview

  • Product name

  • Description

    Rabbit polyclonal to DACH1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human DACH1 aa 292-434.
    Sequence:

    PKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIA EAMKVKKIKLEAMSNYHASNNQHGADSENGDMNSSVGSSDGSWDKETLPS SPSQGPQASITHPRMPGARSLPLSHPLNHLQQSHLLPNGLELP


    Database link: Q9UI36

  • Positive control

    • ICC/IF: A431 cells. IHC-P: Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Transcription factor that is involved in regulation of organogenesis. Seems to be a regulator of SIX1, SIX6 and probably SIX5. Corepression of precursor cell proliferation in myoblasts by SIX1 is switched to coactivation through recruitment of EYA3 to the SIX1-DACH1 complex. Transcriptional activation seems also to involve association of CREBBP. Seems to act as a corepressor of SIX6 in regulating proliferation by directly repressing cyclin-dependent kinase inhibitors, including the p27Kip1 promoter (By similarity). Inhibits TGF-beta signaling through interaction with SMAD4 and NCOR1. Binds to chromatin DNA via its DACHbox-N domain.
  • Tissue specificity

    Widely expressed. Isoform 2 is found in brain, heart, kidney, liver, leukocytes and spleen. Isoform 3 is found in liver and heart. Isoform 4 is found in spleen.
  • Sequence similarities

    Belongs to the DACH/dachshund family.
  • Domain

    The DACHbox-N/DD1 domain forms a structure containing a DNA binding motif similar to that of the forkhead/winged helix domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DACH antibody
    • Dach1 antibody
    • DACH1_HUMAN antibody
    • Dachshund family transcription factor 1 antibody
    • dachshund homolog 1 (Drosophila) antibody
    • Dachshund homolog 1 antibody
    • Dachsund homolog 1 antibody
    • FLJ10138 antibody
    • OTTHUMP00000018494 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for DACH1 (green) using ab223703 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human small intestine tissue stained for DACH1 using ab223703 at 1/50 dilution in immunohistochemical analysis.

References

This product has been referenced in:

  • Wang J  et al. DACH1 inhibits glioma invasion and tumor growth via the Wnt/catenin pathway. Onco Targets Ther 11:5853-5863 (2018). Read more (PubMed: 30271168) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223703.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up