For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    dad1-antibody-ab23836.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Apoptosis Intracellular Associated Proteins
Share by email

Anti-DAD1 antibody (ab23836)

  • Datasheet
  • SDS
Reviews (1)Q&A (1)References (2)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-DAD1 antibody (ab23836)
  • Immunocytochemistry - Anti-DAD1 antibody (ab23836)

Key features and details

  • Rabbit polyclonal to DAD1
  • Suitable for: WB, ICC
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-DAD1 antibody
  • Description

    Rabbit polyclonal to DAD1
  • Host species

    Rabbit
  • Tested Applications & Species

    Application Species
    ICC
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Synthetic peptide corresponding to a 14 amino acid sequence within the C terminal region of DAD 1 (Human).

  • Positive control

    • HepG2 cell lysates.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.02% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Purified by affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Apoptosis
    • Intracellular
    • Associated Proteins

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab23836 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Guaranteed

Tested applications are guaranteed to work and covered by our Abpromise guarantee.

Predicted

Predicted to work for this combination of applications and species but not guaranteed.

Incompatible

Does not work for this combination of applications and species.

Application Species
ICC
Human
WB
Human
Application Abreviews Notes
WB (1)
Use a concentration of 0.5 - 2 µg/ml. Detects a band of approximately 22 kDa (predicted molecular weight: 12 kDa).
ICC
Use at an assay dependent dilution.
Notes
WB
Use a concentration of 0.5 - 2 µg/ml. Detects a band of approximately 22 kDa (predicted molecular weight: 12 kDa).
ICC
Use at an assay dependent dilution.

Target

  • Function

    Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). Loss of the DAD1 protein triggers apoptosis.
  • Sequence similarities

    Belongs to the DAD/OST2 family.
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession P61803 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 1603 Human
    • GenBank: NP_001335.1 Human
    • Omim: 600243 Human
    • SwissProt: P61803 Human
    • Unigene: 82890 Human
    • Alternative names

      • DAD 1 antibody
      • DAD-1 antibody
      • dad1 antibody
      • DAD1_HUMAN antibody
      • Defender against cell death 1 antibody
      • Dolichyl diphosphooligosaccharide protein glycosyltransferase subunit DAD1 antibody
      • Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 antibody
      • Oligosaccharyl transferase subunit DAD1 antibody
      • OST 2 antibody
      • OST2 antibody
      see all

    Images

    • Western blot - Anti-DAD1 antibody (ab23836)
      Western blot - Anti-DAD1 antibody (ab23836)
      Lane 1 : Anti-DAD1 antibody (ab23836) at 0.5 µg/ml
      Lane 2 : Anti-DAD1 antibody (ab23836) at 1 µg/ml
      Lane 3 : Anti-DAD1 antibody (ab23836) at 2 µg/ml

      All lanes : HepG2 whole cell lysate

      Predicted band size: 12 kDa
      Observed band size: 22 kDa why is the actual band size different from the predicted?

    • Immunocytochemistry - Anti-DAD1 antibody (ab23836)
      Immunocytochemistry - Anti-DAD1 antibody (ab23836)
      ab23836 staining DAD1 in HepG2 cells by Immunocytochemistry.

    Protocols

    • Western blot protocols
    • Immunocytochemistry & immunofluorescence protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (2)

    Publishing research using ab23836? Please let us know so that we can cite the reference in this datasheet.

    ab23836 has been referenced in 2 publications.

    • Ding Y  et al. The endoplasmic reticulum-based acetyltransferases, ATase1 and ATase2, associate with the oligosaccharyltransferase to acetylate correctly folded polypeptides. J Biol Chem 289:32044-55 (2014). WB . PubMed: 25301944
    • Murooka TT  et al. CCL5 promotes proliferation of MCF-7 cells through mTOR-dependent mRNA translation. Biochem Biophys Res Commun 387:381-6 (2009). WB ; Human . PubMed: 19607806

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-2 of 2 Abreviews or Q&A

    Western blot abreview for Anti-DAD1 antibody

    Excellent
    Abreviews
    Abreviews
    Application
    Western blot
    Sample
    Human Tissue lysate - whole (skin)
    Loading amount
    15 µg
    Specification
    skin
    Gel Running Conditions
    Non-reduced Denaturing (15% gel)
    Blocking step
    BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 25°C
    Read More

    Abcam user community

    Verified customer

    Submitted Feb 24 2009

    Question

    I am thinking of purchasing DAD1 antibody to use against Xenopus Laevis. The primary accession number is P46967, and the fasta format follows. >sp|P46967|DAD1_XENLA Defender against cell death 1 (DAD-1) - Xenopus laevis (African clawed frog). MSVSVFSVVSRFLDEYVSSTPQRLKLLDAYLLYILLTGALQFLYCLLVGTFPFNSFLSGFISSVGSFILAVCLRIQINPQNKSDFQGISPERAFADFLFANTILHLVVVNFIG I was wondering if you could give me an idea of the chance that your anti body will detect this version of the protein? Thank you

    Read More

    Abcam community

    Verified customer

    Asked on Jan 23 2006

    Answer

    Thank you for your enquiry. I contacted the antibody originator regarding ab23836. Unfortunately the amino acid sequence of the immunogen is proprietary. The only information I have is that the sequence was selected from the last half of the protein, but not the very C-terminus. The amino acid sequence of human DAD1 is in the public domain (GenBank accession no. AAH09798). However, without access to the immunogen sequence I am not in a position to comment on the homology between the relevant sequence in human versus xenopus. I am sorry that I could not assist further. I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

    Read More

    Abcam Scientific Support

    Answered on Jan 24 2006

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.