Anti-DAD1 antibody (ab23836)

Reviews (1)Q&A (1)References (2)
Western blot - Anti-DAD1 antibody (ab23836)
  • Immunocytochemistry - Anti-DAD1 antibody (ab23836)

Key features and details

  • Rabbit polyclonal to DAD1
  • Suitable for: WB, ICC
  • Reacts with: Human
  • Isotype: IgG

Overview

  • Product name

    Anti-DAD1 antibody

  • Description

    Rabbit polyclonal to DAD1

  • Host species

    Rabbit

  • Tested applications

    Suitable for: WB, ICCmore details

  • Species reactivity

    Reacts with: Human

  • Immunogen

    Synthetic peptide corresponding to a 14 amino acid sequence within the C terminal region of DAD 1 (Human).

  • Positive control

    • HepG2 cell lysates.

  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Storage buffer

    Preservative: 0.02% Sodium azide
    Constituent: PBS
  • Concentration information loading...

  • Purity

    Protein A purified

  • Purification notes

    Purified by affinity chromatography.

  • Clonality

    Polyclonal

  • Isotype

    IgG

  • Research areas

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab23836 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB (1)
Use a concentration of 0.5 - 2 µg/ml. Detects a band of approximately 22 kDa (predicted molecular weight: 12 kDa).
ICC
Use at an assay dependent dilution.
Notes
WB
Use a concentration of 0.5 - 2 µg/ml. Detects a band of approximately 22 kDa (predicted molecular weight: 12 kDa).
ICC
Use at an assay dependent dilution.

Target

  • Function

    Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). Loss of the DAD1 protein triggers apoptosis.

  • Sequence similarities

    Belongs to the DAD/OST2 family.

  • Cellular localization

    Membrane.
  • Information by UniProt

  • Database links

    • Alternative names

      • DAD 1 antibody
      • DAD-1 antibody
      • dad1 antibody
      • DAD1_HUMAN antibody
      • Defender against cell death 1 antibody
      • Dolichyl diphosphooligosaccharide protein glycosyltransferase subunit DAD1 antibody
      • Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 antibody
      • Oligosaccharyl transferase subunit DAD1 antibody
      • OST 2 antibody
      • OST2 antibody
      see all

    Images

    • Western blot - Anti-DAD1 antibody (ab23836)
      Western blot - Anti-DAD1 antibody (ab23836)
      Lane 1 : Anti-DAD1 antibody (ab23836) at 0.5 µg/ml
      Lane 2 : Anti-DAD1 antibody (ab23836) at 1 µg/ml
      Lane 3 : Anti-DAD1 antibody (ab23836) at 2 µg/ml

      All lanes : HepG2 whole cell lysate

      Predicted band size: 12 kDa
      Observed band size: 22 kDa why is the actual band size different from the predicted?

    • Immunocytochemistry - Anti-DAD1 antibody (ab23836)
      Immunocytochemistry - Anti-DAD1 antibody (ab23836)
      ab23836 staining DAD1 in HepG2 cells by Immunocytochemistry.

    References (2)

    Publishing research using ab23836? Please let us know so that we can cite the reference in this datasheet.

    ab23836 has been referenced in 2 publications.

    • Ding Y  et al. The endoplasmic reticulum-based acetyltransferases, ATase1 and ATase2, associate with the oligosaccharyltransferase to acetylate correctly folded polypeptides. J Biol Chem 289:32044-55 (2014). WB . PubMed: 25301944
    • Murooka TT  et al. CCL5 promotes proliferation of MCF-7 cells through mTOR-dependent mRNA translation. Biochem Biophys Res Commun 387:381-6 (2009). WB ; Human . PubMed: 19607806

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-2 of 2 Abreviews or Q&A

    Western blot abreview for Anti-DAD1 antibody

     Excellent
    Abreviews
    Application
    Western blot
    Sample
    Human Tissue lysate - whole (skin)
    Loading amount
    15 µg
    Specification
    skin
    Gel Running Conditions
    Non-reduced Denaturing (15% gel)
    Blocking step
    BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 25°C
    Read More

    Abcam user community

    Verified customer

    Submitted Feb 24 2009

    Question

    I am thinking of purchasing DAD1 antibody to use against Xenopus Laevis. The primary accession number is P46967, and the fasta format follows. >sp|P46967|DAD1_XENLA Defender against cell death 1 (DAD-1) - Xenopus laevis (African clawed frog). MSVSVFSVVSRFLDEYVSSTPQRLKLLDAYLLYILLTGALQFLYCLLVGTFPFNSFLSGFISSVGSFILAVCLRIQINPQNKSDFQGISPERAFADFLFANTILHLVVVNFIG I was wondering if you could give me an idea of the chance that your anti body will detect this version of the protein? Thank you

    Read More
    Answer

    Thank you for your enquiry. I contacted the antibody originator regarding ab23836. Unfortunately the amino acid sequence of the immunogen is proprietary. The only information I have is that the sequence was selected from the last half of the protein, but not the very C-terminus. The amino acid sequence of human DAD1 is in the public domain (GenBank accession no. AAH09798). However, without access to the immunogen sequence I am not in a position to comment on the homology between the relevant sequence in human versus xenopus. I am sorry that I could not assist further. I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com