Overview

  • Product name

  • Description

    Rabbit polyclonal to DAOA/G72
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human DAOA/G72 aa 1-153.
    Sequence:

    MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEE GRETVTRKEG WKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEV SSHVGKVFMARNYEFLAYEASK DRRQPLERMWTCNYNQQKDQSCNHKE ITSTKAE


    Database link: P59103

  • Positive control

    • Human brain (cerebellum) tissue
  • General notes

    Previously labelled as DAOA.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab205502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration.
IHC-P Use a concentration of 10 µg/ml.

Target

  • Function

    Seems to activate D-amino acid oxidase.
  • Tissue specificity

    Expressed in amygdala, caudate nucleus, spinal cord and testis.
  • Cellular localization

    Golgi apparatus.
  • Information by UniProt
  • Database links

  • Alternative names

    • D-amino acid oxidase activator antibody
    • DAOA antibody
    • DAOA_HUMAN antibody
    • G72 transcript antibody
    • LG72 antibody
    • Protein G72 antibody
    • Schizophrenia and bipolar disorder associated protein G72 antibody
    • SG72 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human brain cerebellum tissue labeling DAOA/G7 with ab205502 at 10µg/mL. 

References

ab205502 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205502.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up