Anti-DAZAP1 antibody (ab237519)
Key features and details
- Rabbit polyclonal to DAZAP1
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DAZAP1 antibody
See all DAZAP1 primary antibodies -
Description
Rabbit polyclonal to DAZAP1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment corresponding to Human DAZAP1 aa 1-300.
Sequence:MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQS RGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEG WQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEK QRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQ PGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPP AGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPP
Database link: Q96EP5 -
Positive control
- WB: HeLa, Jurkat, HEK-293 and HepG2 whole cell lysates. ICC/IF: HeLa cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab237519 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/2000 - 1/10000. Predicted molecular weight: 43 kDa. | |
| ICC/IF | 1/50 - 1/200. |
Target
-
Function
RNA-binding protein, which may be required during spermatogenesis. -
Tissue specificity
Mainly expressed in testis. Expressed to a lower level in thymus. Weakly or not expressed in heart, liver, brain, placenta, lung, skeletal muscle, kidney and pancreas. -
Sequence similarities
Contains 2 RRM (RNA recognition motif) domains. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Cytoplasm. Nucleus. Predominantly cytoplasmic (By similarity). Nuclear at some stages of spermatozoides development. In midpachytene spermatocytes, it is localized in both the cytoplasm and the nuclei and is clearly excluded from the sex vesicles. In round spermatids, it localizes mainly in the nuclei, whereas in elongated spermatids, it localizes to the cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 26528 Human
- Entrez Gene: 70248 Mouse
- Omim: 607430 Human
- SwissProt: Q96EP5 Human
- SwissProt: Q9JII5 Mouse
- Unigene: 222510 Human
- Unigene: 148693 Mouse
-
Alternative names
- DAZ associated protein 1 antibody
- DAZ-associated protein 1 antibody
- Dazap1 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-DAZAP1 antibody (ab237519)
HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for DAZAP1 (green) using ab237519 at 1/100 dilution in ICC/IF secondary antibody.
-
Western blot - Anti-DAZAP1 antibody (ab237519)All lanes : Anti-DAZAP1 antibody (ab237519) at 1/2000 dilution
Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
Lane 3 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
Lane 4 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 43 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab237519 has not yet been referenced specifically in any publications.
