Overview

  • Product name

  • Description

    Rabbit polyclonal to DBF4B/DRF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DBF4B/DRF1 aa 1-300.
    Sequence:

    MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSG KSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESS GKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQ KAIRNQGSISGGGSGGSSSLLTNARSWGVRILHVDEMMMHVQQLSLASLC VKKQQPKKPEGTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSF PEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRKKGY


    Database link: Q8NFT6

  • Positive control

    • WB: MCF7 and A549 whole cell lysate. IHC-P: Human testis tissue.
  • General notes

     This product was previously labelled as DBF4B

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235528 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000.

Target

  • Function

    Regulatory subunit for CDC7 which activates its kinase activity thereby playing a central role in DNA replication and cell proliferation. Required for progression of S and M phases. The complex CDC7-DBF4B selectively phosphorylates MCM2 subunit at 'Ser-40' and then is involved in regulating the initiation of DNA replication during cell cycle.
  • Tissue specificity

    Widely expressed. Highly expressed in testis.
  • Sequence similarities

    Contains 1 BRCT domain.
    Contains 1 DBF4-type zinc finger.
  • Developmental stage

    Increases as cells enter in S phase through G2/M phase. The protein has a short half-life (at protein level).
  • Post-translational
    modifications

    Phosphorylated.
  • Cellular localization

    Nucleus. Predominantly found in soluble fraction but not in the chromatin-bound fraction.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activator of S phase kinase like protein 1 antibody
    • Activator of S phase kinase-like protein 1 antibody
    • ASK like protein 1 antibody
    • ASK-like protein 1 antibody
    • ASKL1 antibody
    • chifb antibody
    • Chiffon homolog B antibody
    • DBF 4B antibody
    • DBF4 homolog B (S. cerevisiae) antibody
    • DBF4 homolog B antibody
    • Dbf4 related factor 1 antibody
    • Dbf4-related factor 1 antibody
    • dbf4b antibody
    • DBF4B_HUMAN antibody
    • DRF1 antibody
    • FLJ13087 antibody
    • MGC15009 antibody
    • Protein DBF4 homolog B antibody
    • ZDBF1B antibody
    • Zinc finger DBF type containing 1B antibody
    see all

Images

  • All lanes : Anti-DBF4B/DRF1 antibody (ab235528) at 1/500 dilution

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human testis tissue stained for DBF4B/DRF1 using ab235528 at 1/100 dilution in immunohistochemical analysis.

References

ab235528 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235528.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up