Overview

  • Product name

  • Description

    Rabbit polyclonal to DBI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human DBI aa 1-104. (Expressed in E.coli).
    Sequence:

    MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYK QATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKK KYGI


    Database link: P07108-2

  • Positive control

    • WB: Mouse spleen lysate; Recombinant human DBI protein. IHC-P: Human liver tissue.
  • General notes

     This product was previously labelled as Diazepam Binding Inhibitor

     

Properties

Applications

Our Abpromise guarantee covers the use of ab232760 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 10 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
  • Tissue specificity

    Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart.
  • Sequence similarities

    Belongs to the ACBP family.
    Contains 1 ACB (acyl-CoA-binding) domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACBD 1 antibody
    • ACBD1 antibody
    • ACBP antibody
    • ACBP_HUMAN antibody
    • Acyl CoA binding domain containing 1 antibody
    • Acyl CoA binding protein antibody
    • Acyl Coenzyme A binding domain containing 1 antibody
    • Acyl coenzyme A binding protein antibody
    • Acyl-CoA-binding protein antibody
    • CCK RP antibody
    • CCKRP antibody
    • Cholecystokinin releasing peptide trypsin sensitive antibody
    • DBI antibody
    • Diazepam-binding inhibitor antibody
    • Endozepine antibody
    • EP antibody
    • GABA receptor modulator antibody
    • MGC70414 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Diazepam binding protein using ab232760 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-DBI antibody (ab232760) at 3 µg/ml + Mouse spleen tissue

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 10 kDa

  • Anti-DBI antibody (ab232760) at 3 µg/ml + Recombinant human DBI protein

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 10 kDa

References

ab232760 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232760.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up