Overview

  • Product name

    Anti-DBL antibody [OTI2C12]
  • Description

    Mouse monoclonal [OTI2C12] to DBL
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DBL aa 872-1001. Produced in E.coli (NP_001093325).
    Sequence:

    VKMTWLKEIRNILLKQQELLTVKKRKQQDQLTERDKFQISLQQNDEKQQG AFISTEETELEHTSTVVEVCEAIASVQAEANTVWTEASQSAEISEEPAEW SSNYFYPTYDENEEENRPLMRPVSEMALLY


    Database link: P10911-5

  • Positive control

    • WB: pCMV6-ENTRY DBL cDNA transfected HEK-293T cell lysate. IHC-P: Human embryonic cerebellum tissue.
  • General notes

    Previously labelled as MCF2. 

Properties

Applications

Our Abpromise guarantee covers the use of ab236398 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 108 kDa.
IHC-P 1/500.

Heat-induced epitope retrieval by 1 mM EDTA in 10 mM Tris buffer (pH 8.5) at 120°C for 3 minutes.

Target

  • Relevance

    Guanine nucleotide exchange factor (GEF) that modulates the Rho family of GTPases. Promotes the conversion of some member of the Rho family GTPase from the GDP-bound to the GTP-bound form. Isoform 1 exhibits no activity toward RHOA, RAC1 or CDC42. Isoform 2 exhibits decreased GEF activity toward CDC42. Isoform 3 exhibits a weak but significant activity toward RAC1 and CDC42. Isoform 4 exhibits significant activity toward RHOA and CDC42. The truncated DBL oncogene is active toward RHOA, RAC1 and CDC42.
  • Cellular localization

    Cytoplasm Isoform 1: Membrane Isoform 3: Membrane. Note: Colocalizes with CDC42 to plasma membrane.
  • Database links

  • Alternative names

    • DBL antibody
    • DBL-transforming protein antibody
    • MCF2 antibody
    • MCF2-transforming protein antibody
    • Proto-oncogene DBL antibody
    • Proto-oncogene MCF-2 antibody
    see all

Images

  • Paraffin-embedded human embryonic cerebellum tissue stained for DBL using ab236398 at 1/500 dilution in immunohistochemical analysis.

    Heat-induced epitope retrieval was performed using 1 mM EDTA in 10 mM Tris buffer (pH 8.5) at 120°C for 3 minutes.

  • All lanes : Anti-DBL antibody [OTI2C12] (ab236398) at 1/500 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY DBL cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 108 kDa

References

ab236398 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236398.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up