Overview

  • Product name

    Anti-DC-SIGN antibody [5C2G9]
    See all DC-SIGN primary antibodies
  • Description

    Mouse monoclonal [5C2G9] to DC-SIGN
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human DC-SIGN aa 270-404. (Expressed in E.coli).
    Sequence:

    MSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLS DLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKC NLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA


    Database link: Q9NNX6

  • Positive control

    • WB: THP-1, HL-60 and A431 cell lysates; Human DC-SIGN (aa 270-404) recombinant protein; DC-SIGN (aa 270-404)-hIgGFc transfected HEK-293 cell lysate. Flow Cyt: Ramos cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 46 kDa.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response. Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens, including HIV-1 gp120, HIV-2 gp120, SIV gp120, ebolavirus glycoproteins, cytomegalovirus gB, HCV E2, dengue virus gE, Leishmania pifanoi LPG, Lewis-x antigen in Helicobacter pylori LPS, mannose in Klebsiella pneumonae LPS, di-mannose and tri-mannose in Mycobacterium tuberculosis ManLAM and Lewis-x antigen in Schistosoma mansoni SEA.
    On DCs it is a high affinity receptor for ICAM2 and ICAM3 by binding to mannose-like carbohydrates. May act as a DC rolling receptor that mediates transendothelial migration of DC presursors from blood to tissues by binding endothelial ICAM2. Seems to regulate DC-induced T-cell proliferation by binding to ICAM3 on T-cells in the immunological synapse formed between DC and T-cells.
  • Tissue specificity

    Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Domain

    The tandem repeat domain, also called neck domain, mediates oligomerization.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C type lectin domain family 4 member L antibody
    • C-type lectin domain family 4 member L antibody
    • CD 209 antibody
    • CD209 antibody
    • CD209 antigen antibody
    • CD209 antigen-like protein A antibody
    • CD209 molecule antibody
    • CD209_HUMAN antibody
    • Cd209a antibody
    • CDSIGN antibody
    • CIRE antibody
    • CLEC4L antibody
    • DC SIGN antibody
    • DC SIGN1 antibody
    • DC-SIGN antibody
    • DC-SIGN1 antibody
    • DCSIGN antibody
    • Dendritic cell specific ICAM 3 grabbing nonintegrin 1 antibody
    • Dendritic cell specific ICAM3 grabbing nonintegrin 1 antibody
    • Dendritic cell-specific ICAM-3-grabbing non-integrin 1 antibody
    • Dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin antibody
    • Dengue fever, protection against, included antibody
    • Dentritic Cell Specific ICAM3 Grabbing Nonintegrin antibody
    • HIV GP120 Binding Protein antibody
    • MGC129965 antibody
    • MGC130443 antibody
    • SIGN-R1 antibody
    • SIGNR5 antibody
    see all

Images

  • Anti-DC-SIGN antibody [5C2G9] (ab233749) at 1/500 dilution + Human DC-SIGN (aa 270-404) recombinant protein

    Predicted band size: 46 kDa

  • All lanes : Anti-DC-SIGN antibody [5C2G9] (ab233749) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : DC-SIGN (aa 270-404)-hIgGFc transfected HEK-293 cell lysate

    Predicted band size: 46 kDa

  • All lanes : Anti-DC-SIGN antibody [5C2G9] (ab233749) at 1/500 dilution

    Lane 1 : THP-1 (human monocytic leukemia cell line) cell lysate
    Lane 2 : HL-60 (human promyelocytic leukemia cell line) cell lysate
    Lane 3 : A431 (human epidermoid carcinoma cell line) cell lysate

    Predicted band size: 46 kDa

  • Flow cytometric analysis of Ramos (human Burkitt's lymphoma cell line) cells labeling DC-SIGN with ab233749 at 1/200 dilution (green) compared with a negative control (red).

References

ab233749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up