Overview

  • Product name

    Anti-DCAF17 antibody - N-terminal
    See all DCAF17 primary antibodies
  • Description

    Rabbit Polyclonal to DCAF17 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human DCAF17 aa 68-117 (N terminal). The exact sequence is proprietary.
    Sequence:

    FDNYRRCVSSVASEPRKLYEMPKCSKSEKIEDALLWECPVGDILPNSSDY


    Database link: Q5H9S7

  • Positive control

    • 721_B whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab177917 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa.

Target

Images

  • Anti-DCAF17 antibody - N-terminal (ab177917) at 1 µg/ml + 721_B whole cell lysate at 10 µg

    Predicted band size: 59 kDa

References

ab177917 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177917.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up