Overview

  • Product name

  • Description

    Rabbit polyclonal to DCAMKL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human DCAMKL1 aa 390-647. (Expressed in E.coli).
    Sequence:

    YKVGRTIGDGNFAVVKECVERSTAREYALKIIKKSKCRGKEHMIQNEVSI LRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDAS GMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATI VDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRG SGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKELITMMLLVDVDQRFSAV QVLEHPWV


    Database link: O15075

  • Positive control

    • IHC-P: Human prostate, liver, lung cancer, bile duct cancer, stomach cancer and cholangiocarcinoma tissues. WB: Mouse and pig brain lysates; Recombinant human DCAMKL1 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232875 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 82 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Probable kinase that may be involved in a calcium-signaling pathway controlling neuronal migration in the developing brain. May also participate in functions of the mature nervous system.
  • Tissue specificity

    In fetal tissues, highly expressed in brain, detectable in lung and liver, but not in kidney. In adult tissues, expressed ubiquitously in the brain, detectable in the heart, liver, spleen, thymus, prostate, testis, ovary, small intestine and colon. The type A isoforms seem to be expressed predominantly in fetal brain whereas type B isoforms are expressed abundantly in both fetal and adult brain.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
    Contains 2 doublecortin domains.
    Contains 1 protein kinase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calcium/calmodulin-dependent protein kinase type I-like CPG16 antibody
    • CL1 antibody
    • CLICK1 antibody
    • Cpg16 antibody
    • DCDC3A antibody
    • Dcl antibody
    • Dclk antibody
    • Dclk1 antibody
    • DCLK1_HUMAN antibody
    • Doublecortin domain-containing protein 3A antibody
    • Doublecortin-like and CAM kinase-like 1 antibody
    • Doublecortin-like kinase 1 antibody
    • KIAA0369 antibody
    • Serine/threonine-protein kinase DCAMKL1 antibody
    • Serine/threonine-protein kinase DCLK1 antibody
    see all

Images

  • Paraffin-embedded human prostate tissue stained for DCAMKL1 using ab232875 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for DCAMKL1 using ab232875 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human lung cancer tissue stained for DCAMKL1 using ab232875 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human bile duct cancer tissue stained for DCAMKL1 using ab232875 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach cancer tissue stained for DCAMKL1 using ab232875 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-DCAMKL1 antibody (ab232875) at 3 µg/ml + Recombinant human DCAMKL1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 82 kDa

  • All lanes : Anti-DCAMKL1 antibody (ab232875) at 3 µg/ml

    Lane 1 : Pig brain lysate
    Lane 2 : Mouse brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 82 kDa

  • Paraffin-embedded human cholangiocarcinoma tissue stained for DCAMKL1 using ab232875 at 10 µg/ml in immunohistochemical analysis. DAB staining.

References

ab232875 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up