Anti-DCC1 antibody (ab168133)
Key features and details
- Mouse polyclonal to DCC1
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DCC1 antibody
See all DCC1 primary antibodies -
Description
Mouse polyclonal to DCC1 -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Full length protein corresponding to Human DCC1 aa 1-393.
Sequence:MKRTRDEVDATLQIAKLNAAELLPAVHCLGFGPGASGAAAGDFCLLELEP TLCQQLEDGHSLVIRGDKDEQAVLCSKDKTYDLKIADTSNMLLFIPGCKT PDQLKKEDSHCNIIHTEIFGFSNNYWELRRRRPKLKKLKKLLMENPYEGP DSQKEKDSNSSKYTTEDLLDQIQASEEEIMTQLQVLNACKIGGYWRILEF DYEMKLLNHVTQLVDSESWSFGKVPLNTCLQELGPLEPEEMIEHCLKCYG KKYVDEGEVYFELDADKICRAAARMLLQNAVKFNLAEFQEVWQQSVPEGM VTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTE EDIAPYIQDLCGEKQTIGALLTKYSRSSMQNGVKVYNSRRPIS
Database link: NP_076999.1 -
Positive control
- DCC1 transfected 293T cell lysate; A431 cell lysate; HeLa cells.
-
General notes
Previously labelled as DSCC1.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.40
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab168133 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa. | |
ICC/IF | Use a concentration of 10 µg/ml. |
Target
-
Function
Loads PCNA onto primed templates regulating velocity, spacing and restart activity of replication forks. May couple DNA replication to sister chromatid cohesion through regulation of the acetylation of the cohesin subunit SMC3. -
Sequence similarities
Belongs to the DCC1 family. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 79075 Human
- Entrez Gene: 72107 Mouse
- Omim: 613203 Human
- SwissProt: Q9BVC3 Human
- SwissProt: Q14AI0 Mouse
- Unigene: 315167 Human
- Unigene: 277084 Mouse
-
Alternative names
- DCC1 antibody
- DCC1_HUMAN antibody
- Defective in sister chromatid cohesion 1 homolog antibody
see all
Images
-
Anti-DCC1 antibody (ab168133) at 1 µg/ml + A431 cell lysate at 50 µg
Secondary
Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
Predicted band size: 45 kDa -
All lanes : Anti-DCC1 antibody (ab168133) at 1 µg/ml
Lane 1 : DCC1 transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
Lane 1 : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
Lane 2 : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
Predicted band size: 45 kDa -
Immunofluorescence analysis of HeLa cells labeling DCC1 with ab168133 at 10 ug/ml.
Protocols
Datasheets and documents
References (0)
ab168133 has not yet been referenced specifically in any publications.