Overview

  • Product name
    Anti-DCC1 antibody
  • Description
    Mouse polyclonal to DCC1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Full length protein corresponding to Human DCC1 aa 1-393.
    Sequence:

    MKRTRDEVDATLQIAKLNAAELLPAVHCLGFGPGASGAAAGDFCLLELEP TLCQQLEDGHSLVIRGDKDEQAVLCSKDKTYDLKIADTSNMLLFIPGCKT PDQLKKEDSHCNIIHTEIFGFSNNYWELRRRRPKLKKLKKLLMENPYEGP DSQKEKDSNSSKYTTEDLLDQIQASEEEIMTQLQVLNACKIGGYWRILEF DYEMKLLNHVTQLVDSESWSFGKVPLNTCLQELGPLEPEEMIEHCLKCYG KKYVDEGEVYFELDADKICRAAARMLLQNAVKFNLAEFQEVWQQSVPEGM VTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTE EDIAPYIQDLCGEKQTIGALLTKYSRSSMQNGVKVYNSRRPIS


    Database link: NP_076999.1

  • Positive control
    • DCC1 transfected 293T cell lysate; A431 cell lysate; HeLa cells.
  • General notes

    Previously labelled as DSCC1.

Properties

Applications

Our Abpromise guarantee covers the use of ab168133 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    Loads PCNA onto primed templates regulating velocity, spacing and restart activity of replication forks. May couple DNA replication to sister chromatid cohesion through regulation of the acetylation of the cohesin subunit SMC3.
  • Sequence similarities
    Belongs to the DCC1 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • DCC1 antibody
    • DCC1_HUMAN antibody
    • Defective in sister chromatid cohesion 1 homolog antibody
    • Defective in sister chromatid cohesion protein 1 homolog antibody
    • DSCC1 antibody
    • hDCC1 antibody
    • MGC5528 antibody
    • Sister chromatid cohesion protein DCC1 antibody
    see all

Images

  • Anti-DCC1 antibody (ab168133) at 1 µg/ml + A431 cell lysate at 50 µg

    Secondary
    Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Predicted band size: 45 kDa

  • All lanes : Anti-DCC1 antibody (ab168133) at 1 µg/ml

    Lane 1 : DCC1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    Lane 1 : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
    Lane 2 : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Predicted band size: 45 kDa

  • Immunofluorescence analysis of HeLa cells labeling DCC1 with ab168133 at 10 ug/ml.

References

ab168133 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Loading amount
90 µg
Gel Running Conditions
Reduced Denaturing (4-18% gel)
Sample
Mouse Cell lysate - whole cell (Mouse embryonic fibroblasts)
Specification
Mouse embryonic fibroblasts
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Dec 10 2013

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up