Anti-DCHS1 antibody (ab203690)
Key features and details
- Rabbit polyclonal to DCHS1
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DCHS1 antibody
See all DCHS1 primary antibodies -
Description
Rabbit polyclonal to DCHS1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Synthetic peptide within Human DCHS1 aa 1055-1090 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:WVRAALDREAQELYILKVMAVSGSKAELGQQTGTA
Database link: Q96JQ0 -
Positive control
- Human colon carcinoma and lung carcinoma tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab203690 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. When using a fluorescent probe the recommended dilution is 1/50 – 1/200. |
Target
-
Function
Calcium-dependent cell-adhesion protein. -
Tissue specificity
Fibroblast specific. -
Sequence similarities
Contains 27 cadherin domains. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 8642 Human
- Entrez Gene: 233651 Mouse
- Entrez Gene: 308912 Rat
- Omim: 603057 Human
- SwissProt: Q96JQ0 Human
- SwissProt: E9PVD3 Mouse
- SwissProt: D4ACX8 Rat
- Unigene: 199850 Human
see all -
Alternative names
- 3110041P15Rik antibody
- C130033F22Rik antibody
- Cadherin-19 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DCHS1 antibody (ab203690)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon tissue labeling DCHS1 with ab203690 at 1/200 dilution overnight at 4°C followed by Goat Anti-Rabbit IgG, Cy3 conjugated at 1/200 dilution for 40 minutes at 37°C.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DCHS1 antibody (ab203690)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lung tissue labeling DCHS1 with ab203690 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.
Datasheets and documents
References (0)
ab203690 has not yet been referenced specifically in any publications.