Anti-DCHS1 antibody (ab203690)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-DCHS1 antibody
See all DCHS1 primary antibodies -
Description
Rabbit polyclonal to DCHS1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Synthetic peptide within Human DCHS1 aa 1055-1090 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:WVRAALDREAQELYILKVMAVSGSKAELGQQTGTA
Database link: Q96JQ0 -
Positive control
- Human colon carcinoma and lung carcinoma tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab203690 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. When using a fluorescent probe the recommended dilution is 1/50 – 1/200. |
Target
-
Function
Calcium-dependent cell-adhesion protein. -
Tissue specificity
Fibroblast specific. -
Sequence similarities
Contains 27 cadherin domains. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 8642 Human
- Entrez Gene: 233651 Mouse
- Entrez Gene: 308912 Rat
- Omim: 603057 Human
- SwissProt: Q96JQ0 Human
- SwissProt: E9PVD3 Mouse
- SwissProt: D4ACX8 Rat
- Unigene: 199850 Human
see all -
Alternative names
- 3110041P15Rik antibody
- C130033F22Rik antibody
- Cadherin-19 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DCHS1 antibody (ab203690)Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon tissue labeling DCHS1 with ab203690 at 1/200 dilution overnight at 4°C followed by Goat Anti-Rabbit IgG, Cy3 conjugated at 1/200 dilution for 40 minutes at 37°C.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DCHS1 antibody (ab203690)Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lung tissue labeling DCHS1 with ab203690 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.
Protocols
Datasheets and documents
References
ab203690 has not yet been referenced specifically in any publications.
