Anti-DcR3 antibody [3C5H10] (ab233816)
Key features and details
- Mouse monoclonal [3C5H10] to DcR3
- Suitable for: WB, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-DcR3 antibody [3C5H10]
See all DcR3 primary antibodies -
Description
Mouse monoclonal [3C5H10] to DcR3 -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human DcR3 aa 30-300. Expressed in E.coli.
Sequence:VAETPTYPWRDAETGERLVCAQCPPGTFVQRPCRRDSPTTCGPCPPRHYT QFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRTGFFAHAGFCLEH ASCPPGAGVIAPGTPSQNTQCQPCPPGTFSASSSSSEQCQPHRNCTALGL ALNVPGSSSHDTLCTSCTGFPLSTRVPGAEECERAVIDFVAFQDISIKRL QRLLQALEAPEGWGPTPRAGRAALQLKLRRRLTELLGAQDGALLVRLLQA LRVARMPGLERSVRERFLPVH
Database link: O95407 -
Positive control
- WB: Human DcR3 (AA: 30-300) recombinant protein; DcR3 (AA: 30-300)-hIgGFc transfected HEK-293 cell lysate. Flow: HL-60 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
3C5H10 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233816 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. | |
Flow Cyt | 1/200 - 1/400. |
Target
-
Function
Decoy receptor for the cytotoxic ligands TNFS14/LIGHT and TNFSF6/FASL. Protects against apoptosis. -
Tissue specificity
Detected in fetal lung, brain and liver. Detected in adult stomach, spinal cord, lymph node, trachea, spleen, colon and lung. Highly expressed in several primary tumors from colon, stomach, rectum, esophagus and in SW480 colon carcinoma cells. -
Sequence similarities
Contains 4 TNFR-Cys repeats. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 8771 Human
- Omim: 603361 Human
- SwissProt: O95407 Human
- Unigene: 434878 Human
-
Alternative names
- DcR3 antibody
- Decoy receptor 3 antibody
- Decoy receptor for Fas ligand antibody
see all
Images
-
Anti-DcR3 antibody [3C5H10] (ab233816) at 1/500 dilution + Human DcR3 (AA: 30-300) recombinant protein.
Expected MW is 55.7 kDa.
-
All lanes : Anti-DcR3 antibody [3C5H10] (ab233816) at 1/500 dilution
Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate.
Lane 2 : DcR3 (AA: 30-300)-hIgGFc transfected HEK-293 cell lysate. -
Flow cytometric analysis of HL-60 (human promyelocytic leukemia cell line) cells labeling DcR3 using ab233816 at 1/200 dilution (green) and the negative control (red).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233816 has not yet been referenced specifically in any publications.