Anti-DCST1 antibody (ab194559)
Key features and details
- Mouse polyclonal to DCST1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DCST1 antibody -
Description
Mouse polyclonal to DCST1 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment (GST-tag) corresponding to Human DCST1 aa 532-630. NP_689707
Sequence:MESNNMPCLPQPVGLDARAYWRAAVPIGLLVCLCLLQAFGYRLRRVIAAF YFPKREKKRILFLYNDLLKKRAAFTKLRRAAILRRERQQKAPRHPLADI
Database link: Q5T197 -
Positive control
- Daoy cell lysate; recombinant immunogen
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: 50% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Whole antiserum -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab194559 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/2500. Predicted molecular weight: 81 kDa. |
Target
-
Relevance
The function of DCST1 remains unknown. -
Cellular localization
Membrane; Multi-pass membrane protein -
Database links
- Entrez Gene: 149095 Human
- SwissProt: Q5T197 Human
- Unigene: 567717 Human
-
Alternative names
- DC STAMP domain containing 1 antibody
- FLJ32785 antibody
- RP11 307C12.10 antibody
Images
-
Western blot - Anti-DCST1 antibody (ab194559)Anti-DCST1 antibody (ab194559) at 1/500 dilution + Daoy cell lysate at 50 µg
Predicted band size: 81 kDa -
Western blot - Anti-DCST1 antibody (ab194559)Anti-DCST1 antibody (ab194559) at 1/1000 dilution + recombinant immunogen at 0.2 µg
Predicted band size: 81 kDaPredicted MW of immunogen is 37 kDa
Datasheets and documents
References (0)
ab194559 has not yet been referenced specifically in any publications.
