Overview

  • Product name

  • Description

    Mouse polyclonal to DCST1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human DCST1 aa 532-630. NP_689707
    Sequence:

    MESNNMPCLPQPVGLDARAYWRAAVPIGLLVCLCLLQAFGYRLRRVIAAF YFPKREKKRILFLYNDLLKKRAAFTKLRRAAILRRERQQKAPRHPLADI


    Database link: Q5T197

  • Positive control

    • Daoy cell lysate; recombinant immunogen

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 50% Glycerol
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194559 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 81 kDa.

Target

  • Relevance

    The function of DCST1 remains unknown.
  • Cellular localization

    Membrane; Multi-pass membrane protein
  • Database links

  • Alternative names

    • DC STAMP domain containing 1 antibody
    • FLJ32785 antibody
    • RP11 307C12.10 antibody

Images

  • Anti-DCST1 antibody (ab194559) at 1/500 dilution + Daoy cell lysate at 50 µg

    Predicted band size: 81 kDa

  • Anti-DCST1 antibody (ab194559) at 1/1000 dilution + recombinant immunogen at 0.2 µg

    Predicted band size: 81 kDa



    Predicted MW of immunogen is 37 kDa

References

ab194559 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194559.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up