Anti-DCTN3 antibody (ab230012)
Key features and details
- Rabbit polyclonal to DCTN3
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DCTN3 antibody
See all DCTN3 primary antibodies -
Description
Rabbit polyclonal to DCTN3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human DCTN3 aa 1-176.
Sequence:MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSK RERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVAL LEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGS LVEDVGFAQFLSVLHFGPTGPVCGNH
Database link: O75935-2 -
Positive control
- IHC-P: Human pancreatic tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab230012 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. |
Target
-
Function
Together with dynein may be involved in spindle assembly and cytokinesis. -
Tissue specificity
Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain. -
Sequence similarities
Belongs to the dynactin subunit 3 family. -
Cellular localization
Cytoplasm. Cytoplasm > cytoskeleton > centrosome. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > spindle. Cleavage furrow. Midbody. Localizes to punctate cytoplasmic structures and to the centrosome during interphase, and to kinetochores and to spindle poles throughout mitosis. Colocalizes with dynein to the cleavage furrow and to midbody of dividing cells. - Information by UniProt
-
Database links
- Entrez Gene: 11258 Human
- Omim: 607387 Human
- SwissProt: O75935 Human
- Unigene: 511768 Human
-
Alternative names
- DCNT22 antibody
- DCTN 22 antibody
- DCTN22 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DCTN3 antibody (ab230012)Paraffin-embedded human pancreatic tissue stained for DCTN3 using ab230012 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab230012 has not yet been referenced specifically in any publications.
