Overview

  • Product name

  • Description

    Rabbit polyclonal to DCTN5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human DCTN5 aa 91-176.
    Sequence:

    VFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVV PPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKF


    Database link: Q9BTE1

  • Positive control

    • RT-4 and U-251 MG cell lysates; MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221090 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/250 - 1/500. Predicted molecular weight: 20 kDa.

Target

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling DCTN5 with ab221090 at 4 µg/ml (green).  

  • All lanes : Anti-DCTN5 antibody (ab221090) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 20 kDa

References

ab221090 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221090.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up