Overview

  • Product name

  • Description

    Rabbit polyclonal to DCTN6/WS3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Orangutan
  • Immunogen

    Fusion protein corresponding to Human DCTN6/WS3 aa 1-190. (Full length, BC013175).
    Sequence:

    MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVI GEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCYSQAMK MGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLR RVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN


    Database link: O00399

  • Positive control

    • A549 cell lysate; Human gastric cancer tissue.
  • General notes

     This product was previously labelled as DCTN6

     

Properties

Applications

Our Abpromise guarantee covers the use of ab197913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 21 kDa.
IHC-P 1/60 - 1/300.

Target

Images

  • Anti-DCTN6/WS3 antibody (ab197913) at 1/450 dilution + A549 cell lysate at 40 µg

    Developed using the ECL technique.

    Predicted band size: 21 kDa


    Exposure time: 5 minutes


    Gel: 10% SDS-PAGE

  • Immunohistochemical analysis of paraffin-embedded Human gastric cancer tissue labeling DCTN6/WS3 with ab197913 at 1/60 dilution.

References

ab197913 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-8 of 8 Abreviews or Q&A

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (Brain-Primary neuron)
Permeabilization
Yes - 0.2% triton x 100
Specification
Brain-Primary neuron
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 37°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Apr 11 2017

Application
Immunoprecipitation
Sample
Human Cell lysate - whole cell (Kidney)
Total protein in input
1000 µg
Immuno-precipitation step
Protein A/G
Specification
Kidney

Abcam user community

Verified customer

Submitted Feb 01 2017

Application
Western blot
Sample
Human Cell lysate - whole cell (Kidney)
Gel Running Conditions
Non-reduced Non-Denaturing (Native) (4-12)
Loading amount
30 µg
Specification
Kidney
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jan 20 2017

Application
Immunohistochemistry (Frozen sections)
Sample
Human Tissue sections (Brain)
Permeabilization
Yes - 0.3% Triton X-100
Specification
Brain
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 37°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jul 29 2016

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Brain)
Permeabilization
Yes - 0.3% Trotpn X-100
Specification
Brain
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 37°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jul 25 2016

Application
Western blot
Sample
Mouse Tissue lysate - whole (Brain)
Gel Running Conditions
Non-reduced Non-Denaturing (Native)
Loading amount
30 µg
Specification
Brain
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jun 09 2016

Application
Immunocytochemistry/ Immunofluorescence
Sample
Monkey Cell (Kidney)
Permeabilization
Yes - 0.1% troton x-100
Specification
Kidney
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 37°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jun 06 2016

Application
Western blot
Sample
Monkey Cell lysate - whole cell (Kidney)
Gel Running Conditions
Non-reduced Non-Denaturing (Native)
Loading amount
30 µg
Specification
Kidney
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jun 06 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up