Overview

  • Product name

  • Description

    Rabbit polyclonal to DCTN6/WS3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human DCTN6/WS3 aa 1-190.
    Sequence:

    MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVI GEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCYSQAMK MGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLR RVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN


    Database link: O00399

  • Positive control

    • WB: Mouse lung, stomach, thymus and gonadal lysates; A549 and U-251 MG whole cell lysates; Rat brain lysate. IHC-P: Human gastric cancer and kidney tissues. IP: A549 whole cell lysate.
  • General notes

     This product was previously labelled as DCTN6

     

Properties

Applications

Our Abpromise guarantee covers the use of ab230014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 21 kDa.
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-DCTN6/WS3 antibody (ab230014) at 1/1000 dilution

    Lane 1 : Mouse lung lysate
    Lane 2 : Mouse gonadal lysate
    Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 4 : U-251 MG (human brain glioma cell line) whole cell lysate
    Lane 5 : Mouse thymus lysate
    Lane 6 : Rat brain lysate
    Lane 7 : Mouse stomach lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 21 kDa

  • Paraffin-embedded human kidney tissue staned for DCTN6/WS3 using ab230014 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for DCTN6/WS3 using ab230014 at 1/100 dilution in immunohistochemical analysis.

  • DCTN6/WS3 was immunoprecipitated from 500 µg A549 (human lung carcinoma cell line) whole cell lysate with 1 µg of ab230014.

    Lane 1: 1 µg rabbit monoclonal IgG instead of ab230014 in A549 whole cell lysate.

    Lane 2: ab230014 IP in A549 whole cell lysate.

    Lane 3: A549 whole cell lysate 20 µg (input).

    For western blotting, an HRP-conjugated light chain specific antibody was used as the Secondary antibody at 1/50000 dilution.

References

ab230014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up