Anti-DCTN6/WS3 antibody (ab230038)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-DCTN6/WS3 antibody
See all DCTN6/WS3 primary antibodies -
Description
Rabbit polyclonal to DCTN6/WS3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IP, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow, Orangutan -
Immunogen
Recombinant full length protein corresponding to Human DCTN6/WS3 aa 1-190.
Sequence:MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVI GEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCYSQAMK MGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLR RVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN
Database link: O00399 -
Positive control
- WB: A549 and U-251 MG whole cell lysates. IP: A549 whole cell lysate. IHC-P: Human gastric cancer and kidney tissues.
-
General notes
This product was previously labelled as DCTN6
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.3
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab230038 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/5000. Predicted molecular weight: 21 kDa. | |
IP | 1/200 - 1/2000. | |
IHC-P | 1/20 - 1/200. |
Target
-
Tissue specificity
Ubiquitous. -
Sequence similarities
Belongs to the dynactin subunits 5/6 family. Dynactin subunit 6 subfamily. -
Cellular localization
Cytoplasm > cytoskeleton. - Information by UniProt
-
Database links
- Entrez Gene: 513751 Cow
- Entrez Gene: 10671 Human
- Entrez Gene: 22428 Mouse
- Entrez Gene: 100174616 Orangutan
- Omim: 612963 Human
- SwissProt: Q148G7 Cow
- SwissProt: O00399 Human
- SwissProt: Q9WUB4 Mouse
see all -
Alternative names
- DCTN6 antibody
- DCTN6_HUMAN antibody
- Dynactin 6 antibody
see all
Images
-
All lanes : Anti-DCTN6/WS3 antibody (ab230038) at 1/1000 dilution
Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 21 kDa
Observed band size: 21 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DCTN6/WS3 antibody (ab230038)
Paraffin-embedded human gastric cancer tissue stained for DCTN6/WS3 using ab230038 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DCTN6/WS3 antibody (ab230038)
Paraffin-embedded human kidney tissue stained for DCTN6/WS3 using ab230038 at 1/100 dilution in immunohistochemical analysis.
-
DCTN6/WS3 was immunoprecipitated from 0.5 mg A549 (human lung carcinoma cell line) whole cell lysate with 4 µg of ab230038. Western blot was performed from the immunoprecipitate using ab230038. A HRP-conjugated light chain specific antibody was used as the secondary antibody at 1/50000 dilution.
Lane 1: 1 µg Rabbit monoclonal IgG instead of ab230038 in A549 whole cell lysate.
Lane 2: ab230038 IP in A549 whole cell lysate.
Lane 3: A549 whole cell lysate 20 µg (Input).
Datasheets and documents
References
ab230038 has not yet been referenced specifically in any publications.