Anti-DCTN6/WS3 antibody (ab230038)
Key features and details
- Rabbit polyclonal to DCTN6/WS3
- Suitable for: WB, IP, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DCTN6/WS3 antibody
See all DCTN6/WS3 primary antibodies -
Description
Rabbit polyclonal to DCTN6/WS3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IP, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow, Orangutan
-
Immunogen
Recombinant full length protein corresponding to Human DCTN6/WS3 aa 1-190.
Sequence:MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVI GEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCYSQAMK MGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLR RVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN
Database link: O00399 -
Positive control
- WB: A549 and U-251 MG whole cell lysates. IP: A549 whole cell lysate. IHC-P: Human gastric cancer and kidney tissues.
-
General notes
This product was previously labelled as DCTN6
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab230038 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/1000 - 1/5000. Predicted molecular weight: 21 kDa. | |
| IP | 1/200 - 1/2000. | |
| IHC-P | 1/20 - 1/200. |
Target
-
Tissue specificity
Ubiquitous. -
Sequence similarities
Belongs to the dynactin subunits 5/6 family. Dynactin subunit 6 subfamily. -
Cellular localization
Cytoplasm > cytoskeleton. - Information by UniProt
-
Database links
- Entrez Gene: 513751 Cow
- Entrez Gene: 10671 Human
- Entrez Gene: 22428 Mouse
- Entrez Gene: 100174616 Orangutan
- Omim: 612963 Human
- SwissProt: Q148G7 Cow
- SwissProt: O00399 Human
- SwissProt: Q9WUB4 Mouse
see all -
Alternative names
- DCTN6 antibody
- DCTN6_HUMAN antibody
- Dynactin 6 antibody
see all
Images
-
Western blot - Anti-DCTN6/WS3 antibody (ab230038)All lanes : Anti-DCTN6/WS3 antibody (ab230038) at 1/1000 dilution
Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 21 kDa
Observed band size: 21 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DCTN6/WS3 antibody (ab230038)Paraffin-embedded human gastric cancer tissue stained for DCTN6/WS3 using ab230038 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DCTN6/WS3 antibody (ab230038)Paraffin-embedded human kidney tissue stained for DCTN6/WS3 using ab230038 at 1/100 dilution in immunohistochemical analysis.
-
Immunoprecipitation - Anti-DCTN6/WS3 antibody (ab230038)DCTN6/WS3 was immunoprecipitated from 0.5 mg A549 (human lung carcinoma cell line) whole cell lysate with 4 µg of ab230038. Western blot was performed from the immunoprecipitate using ab230038. A HRP-conjugated light chain specific antibody was used as the secondary antibody at 1/50000 dilution.
Lane 1: 1 µg Rabbit monoclonal IgG instead of ab230038 in A549 whole cell lysate.
Lane 2: ab230038 IP in A549 whole cell lysate.
Lane 3: A549 whole cell lysate 20 µg (Input).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab230038 has not yet been referenced specifically in any publications.
