Overview

  • Product name

  • Description

    Rabbit polyclonal to DDAH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human DDAH2 aa 31-265. (Expressed in E.coli).
    Sequence:

    AGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAV IQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEIGDENATLDGTDVL FTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGG PRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGV PPFLLHRGGGDLPNSQEALQKLSDVTLVPVSCSEL


    Database link: O95865

  • Positive control

    • WB: Recombinant human DDAH2 protein; Pig brain lysate; MCF7 cell lysate. IHC-P: Human prostate, brain, colorectal cancer, glioma and stomach cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232694 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232694 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 30 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
  • Tissue specificity

    Detected in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas, and at very low levels in brain.
  • Sequence similarities

    Belongs to the DDAH family.
  • Information by UniProt
  • Database links

  • Alternative names

    • DDAH antibody
    • DDAH II antibody
    • DDAH-2 antibody
    • DDAH2 antibody
    • DDAH2_HUMAN antibody
    • DDAHII antibody
    • Dimethylargininase 2 antibody
    • Dimethylargininase-2 antibody
    • Dimethylarginine dimethylaminohydrolase 2 antibody
    • Dimethylarginine dimethylaminohydrolase II antibody
    • G6a antibody
    • N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 antibody
    • NG dimethylarginine dimethylamino hydrolase homolog antibody
    • NG30 antibody
    • OTTHUMP00000029307 antibody
    • OTTHUMP00000029310 antibody
    • OTTHUMP00000174488 antibody
    • OTTHUMP00000174489 antibody
    • Protein G6a antibody
    • S phase protein antibody
    • S-phase protein antibody
    see all

Images

  • Paraffin-embedded human prostate tissue stained for DDAH2 using ab232694 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human brain tissue stained for DDAH2 using ab232694 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-DDAH2 antibody (ab232694) at 2 µg/ml + Recombinant human DDAH2 protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 30 kDa

  • All lanes : Anti-DDAH2 antibody (ab232694) at 2 µg/ml

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) cell lysate
    Lane 2 : Pig brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 30 kDa

  • Paraffin-embedded human colorectal cancer tissue stained for DDAH2 using ab232694 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for DDAH2 using ab232694 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach cancer tissue stained for DDAH2 using ab232694 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab232694 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry free floating
Sample
Mouse Tissue sections (brain)
Specification
brain

Abcam user community

Verified customer

Submitted Feb 12 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up