Recombinant
RabMAb

Recombinant Anti-DDB1 antibody [EPR6089] (ab109027)

Submit a review Q&A (1)References (8)

Overview

  • Product name

    Anti-DDB1 antibody [EPR6089]
    See all DDB1 primary antibodies

  • Description

    Rabbit monoclonal [EPR6089] to DDB1

  • Host species

    Rabbit

  • Tested applications

    Suitable for: ICC/IF, WB, IP, IHC-P, ICCmore details
    Unsuitable for: Flow Cyt

  • Species reactivity

    Reacts with: Mouse, Rat, Human

  • Immunogen

    Synthetic peptide within Human DDB1 aa 1100-1200 (C terminal). The exact sequence is proprietary.

  • Positive control

    • HepG2, HeLa, NIH3T3, and Human platelet lysates, Human breast tissue. This antibody gave a positive result when used in the following formaldehyde fixed cell lines: UV-treated HeLa

  • General notes

    This product is a recombinant monoclonal antibody, which offers several advantages including:

    • - High batch-to-batch consistency and reproducibility
    • - Improved sensitivity and specificity
    • - Long-term security of supply
    • - Animal-free production
    For more information see here.

    Our RabMAb® technology is a patented hybridoma-based technology for making rabbit monoclonal antibodies. For details on our patents, please refer to RabMAb® patents.

Properties

Applications

Our Abpromise guarantee covers the use of ab109027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/100.
WB 1/50000 - 1/200000. Detects a band of approximately 130 kDa (predicted molecular weight: 127 kDa).
IP 1/10 - 1/100.
IHC-P 1/100 - 1/250. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
ICC 1/50 - 1/100.
  • Application notes
    Is unsuitable for Flow Cyt.

    • Target

    • Function

      Required for DNA repair. Binds to DDB2 to form the UV-damaged DNA-binding protein complex (the UV-DDB complex). The UV-DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The UV-DDB complex preferentially binds to cyclobutane pyrimidine dimers (CPD), 6-4 photoproducts (6-4 PP), apurinic sites and short mismatches. Also appears to function as a component of numerous distinct DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. The functional specificity of the DCX E3 ubiquitin-protein ligase complex is determined by the variable substrate recognition component recruited by DDB1. DCX(DDB2) (also known as DDB1-CUL4-ROC1, CUL4-DDB-ROC1 and CUL4-DDB-RBX1) may ubiquitinate histone H2A, histone H3 and histone H4 at sites of UV-induced DNA damage. The ubiquitination of histones may facilitate their removal from the nucleosome and promote subsequent DNA repair. DCX(DDB2) also ubiquitinates XPC, which may enhance DNA-binding by XPC and promote NER. DCX(DTL) plays a role in PCNA-dependent polyubiquitination of CDT1 and MDM2-dependent ubiquitination of TP53 in response to radiation-induced DNA damage and during DNA replication. DCX(ERCC8) (the CSA complex) plays a role in transcription-coupled repair (TCR). May also play a role in ubiquitination of CDKN1B/p27kip when associated with CUL4 and SKP2.

    • Pathway

      Protein modification; protein ubiquitination.

    • Sequence similarities

      Belongs to the DDB1 family.

    • Post-translational
      modifications

      Ubiquitinated by CUL4A. Subsequently degraded by ubiquitin-dependent proteolysis.

    • Cellular localization

      Cytoplasm. Nucleus. Primarily cytoplasmic. Translocates to the nucleus following UV irradiation and subsequently accumulates at sites of DNA damage.
    • Information by UniProt

    • Database links

      see all

    • Alternative names

      • Damage specific DNA binding protein 1 antibody
      • Damage-specific DNA-binding protein 1 antibody
      • DDB 1 antibody
      • DDB p127 subunit antibody
      • Ddb1 antibody
      • DDB1_HUMAN antibody
      • DDBa antibody
      • DNA damage binding protein 1 antibody
      • DNA damage-binding protein 1 antibody
      • DNA damage-binding protein a antibody
      • HBV X-associated protein 1 antibody
      • UV damaged DNA binding factor antibody
      • UV damaged DNA binding protein 1 antibody
      • UV DDB 1 antibody
      • UV DDB1 antibody
      • UV-damaged DNA-binding factor antibody
      • UV-damaged DNA-binding protein 1 antibody
      • UV-DDB 1 antibody
      • X associated protein 1 antibody
      • XAP 1 antibody
      • XAP-1 antibody
      • XAP1 antibody
      • Xeroderma pigmentosum group E complementing protein antibody
      • Xeroderma pigmentosum group E-complementing protein antibody
      • XPCe antibody
      • XPE antibody
      • XPE BF antibody
      • XPE binding factor antibody
      • XPE-BF antibody
      • XPE-binding factor antibody
      see all

    Images

    • Western blot - Anti-DDB1 antibody [EPR6089] (ab109027)
      Western blot - Anti-DDB1 antibody [EPR6089] (ab109027)
      All lanes : Anti-DDB1 antibody [EPR6089] (ab109027) at 1/50000 dilution

      Lane 1 : HepG2 cell lysate
      Lane 2 : HeLa cell lysate
      Lane 3 : NIH3T3 cell lysate
      Lane 4 : Human platelet lysate

      Lysates/proteins at 10 µg per lane.

      Predicted band size: 127 kDa

    • Immunocytochemistry/ Immunofluorescence - Anti-DDB1 antibody [EPR6089] (ab109027)
      Immunocytochemistry/ Immunofluorescence - Anti-DDB1 antibody [EPR6089] (ab109027)

      ab109027 stained UV-treated HeLa cells. The cells were 4% formaldehyde fixed for 10 minutes at room temperature and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1hour at room temperature to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab109027 at 1/100 dilution) overnight at +4°C. The secondary antibody (pseudo-colored green) was ab150081 used at a 1/1000 dilution for 1hour at room temperature. Alexa Fluor® 594 WGA was used to label plasma membranes (pseudo-colored red) at a 1/200 dilution for 1hour at room temperature. DAPI was used to stain the cell nuclei (pseudo-colored blue) at a concentration of 1.43µM for 1hour at room temperature.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DDB1 antibody [EPR6089] (ab109027)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DDB1 antibody [EPR6089] (ab109027)

      Immunohistochemical analysis of paraffin-embedded Human breast tissue using ab109027 at a dilution of 1/100.

      Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

    • Other - Anti-DDB1 antibody [EPR6089] (ab109027)
      Other - Anti-DDB1 antibody [EPR6089] (ab109027)
      Equilibrium disassociation constant (KD)
      Learn more about KD

      Click here to learn more about KD

    References

    This product has been referenced in:

    • Michelena J  et al. Basal CHK1 activity safeguards its stability to maintain intrinsic S-phase checkpoint functions. J Cell Biol 218:2865-2875 (2019). Read more (PubMed: 31366665) »
    • Jang SM  et al. The replication initiation determinant protein (RepID) modulates replication by recruiting CUL4 to chromatin. Nat Commun 9:2782 (2018). Read more (PubMed: 30018425) »
    See all 8 Publications for this product

    Publishing research using ab109027? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    Bonjour,
    La séquence que j'ai obtenue sur pubmed est la suivante:
    MSYNYVVTAQKPTAVNACVTGHFTSEDDLNLLIAKNTRLEIYVVTPEGLRPVKEVGMYGKIAVMELFRPK
    GESKDLLFILTAKYNACILEYKQSGDSIDIITRAHGNVQDRIGRPSETGIIGIIDPDCRMIGLRLYDGLF
    KVIPLERDNKELKAFNIRLEELHVIDVKFLYSCQAPTICFVYQDPQGRHVKTYEVSLREKEFSKGPWKQE
    NVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDVNGSRYLLGDMEGRL
    FMLLLEKEEQMDGSVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLTTESNEQGSYVVVM
    ETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRVAADRD
    TDDTLVLSFVGQTRVLTLTGEEVEETDLAGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQNPQNLVSEW
    KEPQGRKVSVCSCNSRQVLLAVGRVLYYLEIHPGELRQTSCTEMEHEVACLDVTPLGGNDTLSSLCAIGL
    WTDISARILSLPGFQLLHKEMLGGEIIPRSILMTSFESSHYLLCALGDGALFYFSLNTDTGLLSDRKKVT
    LGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSEGYPDSLALANNSTLT
    IGTIDEIQKLHIRTVPLFESPRKICYQEVSQCFGVLSSRIEVQDASGGSSPLRPSASTQALSSSVSCSKL
    FSGSTSPHETSFGEEVEVHNLLIIDQHTFEVLHTHQFLQNEYTLSLVSCKLGKDPTTYFVVGTAMVYPDE
    AEPKQGRIVVFQYNDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTAEKELRTECNHYNNIM
    ALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKD
    SAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSPPTQGSVLFGTVNGMIGLVTSLSESWYNL
    LLDVQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVIANLQIDDGSGM
    KRETTVDDLIKVVEELTRIH

    Je souhaite utiliser l'anticorps en WB et suivant le résultat obtenu, en IP.
    Cordialement

    Read More
    Answer

    Merci de votre intérêt pour ab21080 et merci pour m'avoir fourni la séquence de la DDB1 du xénope.

    Nous avons à notre catalogue deux anticorps anti-DDB1 testés en Western Blot et en IP; le polyclonal de lapin ab21080 (https://www.abcam.com/ab21080) et le monoclonal de lapin ab109027 (https://www.abcam.com/ab109027).
    Ces deux anticorps sont dirigés vers la partie C-terminale de la DDB1 humaine. Les 30 acides aminés de la DDB1 humaine présentent 90% d'homologie avec la séquence de la DDB1 du xénope. Ces 2 anticorps ont donc de bonnes chances de fonctionner chez le xénope.

    Ces deux anticorps n’ont pas encore été testés chez le xénope et nous n’offrons pas d’échantillon gratuit à des fins de tests préliminaires.
    Cependant, si vous souhaitez tester ab21080 ou ab109027 chez le xénope, il me sera possible de vous offrir une remise.
    Après soumission d’une Abreview avec vos résultats, un anticorps primaire de votre choix vous sera offert.

    Etapes à suivre :

    1. Nous confirmer que vous souhaiteriez tester ab21080 ou ab109027 chez le xénope afin de recevoir le code de remise correspondant. Ce code doit être édité avant l’achat de ab21080 ou ab109027

    2. Acheter ab21080 ou ab109027 par téléphone, fax ou internet (https://www.abcam.com)

    3. Le tester chez le xénope

    4. Nous faire part de vos résultats, positifs ou négatifs, grâce à notre système Abreview. Pour plus d’informations https://www.abcam.com/abreviews

    5. Après soumission de votre Abreview, appeler notre service clientèle afin de passer votre prochaine commande grâce au code de réduction. Ce code de réduction est utilisable 120 jours après son édition et utilisable lors de l’achat d’un autre anticorps primaire.
    Même si ab21080 ou ab109027 ne pas fonctionne pas chez le xénope, après soumission de votre Abreview, vous recevrez quand même gratuitement un anticorps primaire de votre choix.

    N’hésitez pas à nous demander plus d’informations concernant cette offre promotionnelle.

    Termes et Conditions : https://www.abcam.com/collaborationdiscount.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com