For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    ddb1-antibody-epr6089-ab109027.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling DNA / RNA DNA Damage & Repair DNA Damage Response DNA Damage Recognition
Share by email
RecombinantRabMAb

Recombinant Anti-DDB1 antibody [EPR6089] (ab109027)

  • Datasheet
  • SDS
Submit a review Q&A (1)References (13)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-DDB1 antibody [EPR6089] (ab109027)
  • Immunocytochemistry/ Immunofluorescence - Anti-DDB1 antibody [EPR6089] (ab109027)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DDB1 antibody [EPR6089] (ab109027)
  • Immunocytochemistry/ Immunofluorescence - Anti-DDB1 antibody [EPR6089] (ab109027)
  • OI-RD Scanning - Anti-DDB1 antibody [EPR6089] (ab109027)
  • Anti-DDB1 antibody [EPR6089] (ab109027)

Key features and details

  • Produced recombinantly (animal-free) for high batch-to-batch consistency and long term security of supply
  • Rabbit monoclonal [EPR6089] to DDB1
  • Suitable for: ICC/IF, WB, IHC-P
  • Reacts with: Mouse, Human

You may also be interested in

Protein
Product image
Recombinant Human DDB1 protein (ab114333)
Protein
Recombinant Enhanced GFP protein (His tag) (ab134853)
Primary
Product image
Anti-Ubiquitin antibody [EPR8830] (ab134953)

View more associated products

Overview

  • Product name

    Anti-DDB1 antibody [EPR6089]
    See all DDB1 primary antibodies
  • Description

    Rabbit monoclonal [EPR6089] to DDB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
    Unsuitable for: Flow Cyt
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide. This information is proprietary to Abcam and/or its suppliers.

  • Positive control

    • HepG2, HeLa, NIH3T3, and Human platelet lysates, Human breast tissue. This antibody gave a positive result when used in the following formaldehyde fixed cell lines: UV-treated HeLa
  • General notes

    This product is a recombinant monoclonal antibody, which offers several advantages including:

    • - High batch-to-batch consistency and reproducibility
    • - Improved sensitivity and specificity
    • - Long-term security of supply
    • - Animal-free production
    For more information see here.

    Our RabMAb® technology is a patented hybridoma-based technology for making rabbit monoclonal antibodies. For details on our patents, please refer to RabMAb® patents.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C.
  • Dissociation constant (KD)

    KD = 8.40 x 10 -11 M
    Learn more about KD
  • Storage buffer

    pH: 7.20
    Preservative: 0.05% Sodium azide
    Constituents: 0.1% BSA, 40% Glycerol (glycerin, glycerine), 9.85% Tris glycine, 50% Tissue culture supernatant
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Clone number

    EPR6089
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • DNA Damage & Repair
    • DNA Damage Response
    • DNA Damage Recognition

Associated products

  • Alternative Versions

    • HRP Anti-DDB1 antibody [EPR6089] (ab199026)
    • Anti-DDB1 antibody [EPR6089] - BSA and Azide free (ab239941)
  • Isotype control

    • Rabbit IgG, monoclonal [EPR25A] - Isotype Control (ab172730)
  • Positive Controls

    • HeLa nuclear extract lysate (ab14655)
    • Hep G2 cytoplasmic extract lysate (ab14659)
    • Hep G2 nuclear extract lysate (ab14660)
    • NIH/3T3 cytoplasmic extract lysate (ab14873)
    • NIH/3T3 nuclear extract lysate (ab14874)
  • Recombinant Protein

    • Recombinant Human DDB1 protein (ab114333)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab109027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF
1/100.
WB
1/50000 - 1/200000. Detects a band of approximately 130 kDa (predicted molecular weight: 127 kDa).
IHC-P
1/100 - 1/250. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
Notes
ICC/IF
1/100.
WB
1/50000 - 1/200000. Detects a band of approximately 130 kDa (predicted molecular weight: 127 kDa).
IHC-P
1/100 - 1/250. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
  • Application notes
    Is unsuitable for Flow Cyt.
  • Target

    • Function

      Required for DNA repair. Binds to DDB2 to form the UV-damaged DNA-binding protein complex (the UV-DDB complex). The UV-DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The UV-DDB complex preferentially binds to cyclobutane pyrimidine dimers (CPD), 6-4 photoproducts (6-4 PP), apurinic sites and short mismatches. Also appears to function as a component of numerous distinct DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. The functional specificity of the DCX E3 ubiquitin-protein ligase complex is determined by the variable substrate recognition component recruited by DDB1. DCX(DDB2) (also known as DDB1-CUL4-ROC1, CUL4-DDB-ROC1 and CUL4-DDB-RBX1) may ubiquitinate histone H2A, histone H3 and histone H4 at sites of UV-induced DNA damage. The ubiquitination of histones may facilitate their removal from the nucleosome and promote subsequent DNA repair. DCX(DDB2) also ubiquitinates XPC, which may enhance DNA-binding by XPC and promote NER. DCX(DTL) plays a role in PCNA-dependent polyubiquitination of CDT1 and MDM2-dependent ubiquitination of TP53 in response to radiation-induced DNA damage and during DNA replication. DCX(ERCC8) (the CSA complex) plays a role in transcription-coupled repair (TCR). May also play a role in ubiquitination of CDKN1B/p27kip when associated with CUL4 and SKP2.
    • Pathway

      Protein modification; protein ubiquitination.
    • Sequence similarities

      Belongs to the DDB1 family.
    • Post-translational
      modifications

      Ubiquitinated by CUL4A. Subsequently degraded by ubiquitin-dependent proteolysis.
    • Cellular localization

      Cytoplasm. Nucleus. Primarily cytoplasmic. Translocates to the nucleus following UV irradiation and subsequently accumulates at sites of DNA damage.
    • Target information above from: UniProt accession Q16531 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 100290337 Human
      • Entrez Gene: 1642 Human
      • Entrez Gene: 13194 Mouse
      • Entrez Gene: 64470 Rat
      • Omim: 600045 Human
      • SwissProt: Q16531 Human
      • SwissProt: Q3U1J4 Mouse
      • SwissProt: Q9ESW0 Rat
      • Unigene: 290758 Human
      • Unigene: 289915 Mouse
      • Unigene: 466856 Mouse
      • Unigene: 8402 Rat
      see all
    • Alternative names

      • Damage specific DNA binding protein 1 antibody
      • Damage-specific DNA-binding protein 1 antibody
      • DDB 1 antibody
      • DDB p127 subunit antibody
      • Ddb1 antibody
      • DDB1_HUMAN antibody
      • DDBa antibody
      • DNA damage binding protein 1 antibody
      • DNA damage-binding protein 1 antibody
      • DNA damage-binding protein a antibody
      • HBV X-associated protein 1 antibody
      • UV damaged DNA binding factor antibody
      • UV damaged DNA binding protein 1 antibody
      • UV DDB 1 antibody
      • UV DDB1 antibody
      • UV-damaged DNA-binding factor antibody
      • UV-damaged DNA-binding protein 1 antibody
      • UV-DDB 1 antibody
      • X associated protein 1 antibody
      • XAP 1 antibody
      • XAP-1 antibody
      • XAP1 antibody
      • Xeroderma pigmentosum group E complementing protein antibody
      • Xeroderma pigmentosum group E-complementing protein antibody
      • XPCe antibody
      • XPE antibody
      • XPE BF antibody
      • XPE binding factor antibody
      • XPE-BF antibody
      • XPE-binding factor antibody
      see all

    Images

    • Western blot - Anti-DDB1 antibody [EPR6089] (ab109027)
      Western blot - Anti-DDB1 antibody [EPR6089] (ab109027)
      All lanes : Anti-DDB1 antibody [EPR6089] (ab109027) at 1/50000 dilution

      Lane 1 : HepG2 cell lysate
      Lane 2 : HeLa cell lysate
      Lane 3 : NIH3T3 cell lysate
      Lane 4 : Human platelet lysate

      Lysates/proteins at 10 µg per lane.

      Predicted band size: 127 kDa

    • Immunocytochemistry/ Immunofluorescence - Anti-DDB1 antibody [EPR6089] (ab109027)
      Immunocytochemistry/ Immunofluorescence - Anti-DDB1 antibody [EPR6089] (ab109027)

      Immunocytochemistry analysis of NIH/3T3 (mouse embryonic fibroblast) cells labeling DDB1 with ab109027 at 1/250 (8.9 μg/mL). Cells were fixed with 4% Paraformaldehyde and permeabilised with 0.1% tritonX-100. ab150077 AlexaFluor®488 Goat anti-Rabbit at 1/1000 (2 μg/mL) was used as the secondary antibody. DAPI (blue) was used as nuclear counterstain.

      Confocal image showing nuclear and cytoplasmic staining in NIH/3T3 cells.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DDB1 antibody [EPR6089] (ab109027)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DDB1 antibody [EPR6089] (ab109027)

      Immunohistochemical analysis of paraffin-embedded Human breast tissue using ab109027 at a dilution of 1/100. Antigen retrieval was heat mediated before commencing with IHC staining protocol.

    • Immunocytochemistry/ Immunofluorescence - Anti-DDB1 antibody [EPR6089] (ab109027)
      Immunocytochemistry/ Immunofluorescence - Anti-DDB1 antibody [EPR6089] (ab109027)

      ab109027 stained UV-treated HeLa cells. The cells were 4% formaldehyde fixed for 10 minutes at room temperature and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1hour at room temperature to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab109027 at 1/100 dilution) overnight at +4°C. The secondary antibody (pseudo-colored green) was ab150081 used at a 1/1000 dilution for 1hour at room temperature. Alexa Fluor® 594 WGA was used to label plasma membranes (pseudo-colored red) at a 1/200 dilution for 1hour at room temperature. DAPI was used to stain the cell nuclei (pseudo-colored blue) at a concentration of 1.43µM for 1hour at room temperature.

    • OI-RD Scanning - Anti-DDB1 antibody [EPR6089] (ab109027)
      OI-RD Scanning - Anti-DDB1 antibody [EPR6089] (ab109027)
      Equilibrium disassociation constant (KD)
      Learn more about KD

      Click here to learn more about KD
    • Anti-DDB1 antibody [EPR6089] (ab109027)
      Anti-DDB1 antibody [EPR6089] (ab109027)

    Protocols

    • Immunohistochemistry protocols
    • Immunocytochemistry & immunofluorescence protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (13)

    Publishing research using ab109027? Please let us know so that we can cite the reference in this datasheet.

    ab109027 has been referenced in 13 publications.

    • Okur MN  et al. Cockayne syndrome group A and B proteins function in rRNA transcription through nucleolin regulation. Nucleic Acids Res 48:2473-2485 (2020). PubMed: 31970402
    • Lu H  et al. DNA-PKcs promotes chromatin decondensation to facilitate initiation of the DNA damage response. Nucleic Acids Res 47:9467-9479 (2019). PubMed: 31396623
    • Kim K  et al. Disordered region of cereblon is required for efficient degradation by proteolysis-targeting chimera. Sci Rep 9:19654 (2019). PubMed: 31873151
    • Zhang Y  et al. Role of Damage DNA-Binding Protein 1 in Pancreatic Cancer Progression and Chemoresistance. Cancers (Basel) 11:N/A (2019). PubMed: 31842285
    • Lu G  et al. Suppression of autophagy during mitosis via CUL4-RING ubiquitin ligases-mediated WIPI2 polyubiquitination and proteasomal degradation. Autophagy 15:1917-1934 (2019). PubMed: 30898011
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    Bonjour,
    La séquence que j'ai obtenue sur pubmed est la suivante:
    MSYNYVVTAQKPTAVNACVTGHFTSEDDLNLLIAKNTRLEIYVVTPEGLRPVKEVGMYGKIAVMELFRPK
    GESKDLLFILTAKYNACILEYKQSGDSIDIITRAHGNVQDRIGRPSETGIIGIIDPDCRMIGLRLYDGLF
    KVIPLERDNKELKAFNIRLEELHVIDVKFLYSCQAPTICFVYQDPQGRHVKTYEVSLREKEFSKGPWKQE
    NVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDVNGSRYLLGDMEGRL
    FMLLLEKEEQMDGSVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLTTESNEQGSYVVVM
    ETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRVAADRD
    TDDTLVLSFVGQTRVLTLTGEEVEETDLAGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQNPQNLVSEW
    KEPQGRKVSVCSCNSRQVLLAVGRVLYYLEIHPGELRQTSCTEMEHEVACLDVTPLGGNDTLSSLCAIGL
    WTDISARILSLPGFQLLHKEMLGGEIIPRSILMTSFESSHYLLCALGDGALFYFSLNTDTGLLSDRKKVT
    LGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSEGYPDSLALANNSTLT
    IGTIDEIQKLHIRTVPLFESPRKICYQEVSQCFGVLSSRIEVQDASGGSSPLRPSASTQALSSSVSCSKL
    FSGSTSPHETSFGEEVEVHNLLIIDQHTFEVLHTHQFLQNEYTLSLVSCKLGKDPTTYFVVGTAMVYPDE
    AEPKQGRIVVFQYNDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTAEKELRTECNHYNNIM
    ALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKD
    SAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSPPTQGSVLFGTVNGMIGLVTSLSESWYNL
    LLDVQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVIANLQIDDGSGM
    KRETTVDDLIKVVEELTRIH

    Je souhaite utiliser l'anticorps en WB et suivant le résultat obtenu, en IP.
    Cordialement

    Read More

    Abcam community

    Verified customer

    Asked on Sep 26 2012

    Answer

    Merci de votre intérêt pour ab21080 et merci pour m'avoir fourni la séquence de la DDB1 du xénope.

    Nous avons à notre catalogue deux anticorps anti-DDB1 testés en Western Blot et en IP; le polyclonal de lapin ab21080 (https://www.abcam.com/ab21080) et le monoclonal de lapin ab109027 (https://www.abcam.com/ab109027).
    Ces deux anticorps sont dirigés vers la partie C-terminale de la DDB1 humaine. Les 30 acides aminés de la DDB1 humaine présentent 90% d'homologie avec la séquence de la DDB1 du xénope. Ces 2 anticorps ont donc de bonnes chances de fonctionner chez le xénope.

    Ces deux anticorps n’ont pas encore été testés chez le xénope et nous n’offrons pas d’échantillon gratuit à des fins de tests préliminaires.
    Cependant, si vous souhaitez tester ab21080 ou ab109027 chez le xénope, il me sera possible de vous offrir une remise.
    Après soumission d’une Abreview avec vos résultats, un anticorps primaire de votre choix vous sera offert.

    Etapes à suivre :

    1. Nous confirmer que vous souhaiteriez tester ab21080 ou ab109027 chez le xénope afin de recevoir le code de remise correspondant. Ce code doit être édité avant l’achat de ab21080 ou ab109027

    2. Acheter ab21080 ou ab109027 par téléphone, fax ou internet (https://www.abcam.com)

    3. Le tester chez le xénope

    4. Nous faire part de vos résultats, positifs ou négatifs, grâce à notre système Abreview. Pour plus d’informations https://www.abcam.com/abreviews

    5. Après soumission de votre Abreview, appeler notre service clientèle afin de passer votre prochaine commande grâce au code de réduction. Ce code de réduction est utilisable 120 jours après son édition et utilisable lors de l’achat d’un autre anticorps primaire.
    Même si ab21080 ou ab109027 ne pas fonctionne pas chez le xénope, après soumission de votre Abreview, vous recevrez quand même gratuitement un anticorps primaire de votre choix.

    N’hésitez pas à nous demander plus d’informations concernant cette offre promotionnelle.

    Termes et Conditions : https://www.abcam.com/collaborationdiscount.

    Read More

    Abcam Scientific Support

    Answered on Sep 26 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.