Anti-DDB2 antibody (ab175409)
Key features and details
- Rabbit polyclonal to DDB2
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DDB2 antibody
See all DDB2 primary antibodies -
Description
Rabbit polyclonal to DDB2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow -
Immunogen
Recombinant full length protein corresponding to Human DDB2 aa 1-427.
Sequence:MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDS DCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDS YRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFI KGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTI NIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVAL NPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNL IVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEF NPMGDTLASAMGYHILIWSQEEARTRK
Database link: Q92466 -
Positive control
- HeLa and A431 cell extracts.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175409 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use at an assay dependent concentration.
|
|
IHC-P |
1/50 - 1/200.
ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
|
WB |
1/500 - 1/2000. Predicted molecular weight: 48 kDa.
|
Notes |
---|
ICC/IF
Use at an assay dependent concentration. |
IHC-P
1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
WB
1/500 - 1/2000. Predicted molecular weight: 48 kDa. |
Target
-
Function
Required for DNA repair. Binds to DDB1 to form the UV-damaged DNA-binding protein complex (the UV-DDB complex). The UV-DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The UV-DDB complex preferentially binds to cyclobutane pyrimidine dimers (CPD), 6-4 photoproducts (6-4 PP), apurinic sites and short mismatches. Also appears to function as the substrate recognition module for the DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex DDB1-CUL4-ROC1 (also known as CUL4-DDB-ROC1 and CUL4-DDB-RBX1). The DDB1-CUL4-ROC1 complex may ubiquitinate histone H2A, histone H3 and histone H4 at sites of UV-induced DNA damage. The ubiquitination of histones may facilitate their removal from the nucleosome and promote subsequent DNA repair. The DDB1-CUL4-ROC1 complex also ubiquitinates XPC, which may enhance DNA-binding by XPC and promote NER. Isoform D1 and isoform D2 inhibit UV-damaged DNA repair. -
Tissue specificity
Ubiquitously expressed; with highest levels in corneal endothelium and lowest levels in brain. Isoform D1 is highly expressed in brain and heart. Isoform D2, isoform D3 and isoform D4 are weakly expressed. -
Pathway
Protein modification; protein ubiquitination. -
Involvement in disease
Defects in DDB2 are a cause of xeroderma pigmentosum complementation group E (XP-E) [MIM:278740]; also known as xeroderma pigmentosum V (XP5). XP-E is a rare human autosomal recessive disease characterized by solar sensitivity, high predisposition for developing cancers on areas exposed to sunlight and, in some cases, neurological abnormalities. -
Sequence similarities
Belongs to the WD repeat DDB2/WDR76 family.
Contains 5 WD repeats. -
Domain
The DWD box is required for interaction with DDB1. -
Post-translational
modificationsPhosphorylation by ABL1 negatively regulate UV-DDB activity.
Ubiquitinated by CUL4A in response to UV irradiation. Ubiquitination appears to both impair DNA-binding and promotes ubiquitin-dependent proteolysis. Degradation of DDB2 at sites of DNA damage may be a prerequisite for their recognition by XPC and subsequent repair. CUL4A-mediated degradation appears to be promoted by ABL1. -
Cellular localization
Nucleus. Accumulates at sites of DNA damage following UV irradiation. - Information by UniProt
-
Database links
- Entrez Gene: 519357 Cow
- Entrez Gene: 1643 Human
- Omim: 600811 Human
- SwissProt: Q0VBY8 Cow
- SwissProt: Q92466 Human
- Unigene: 700338 Human
-
Alternative names
- damage-specific DNA binding protein 2 antibody
- Damage-specific DNA-binding protein 2 antibody
- DDB p48 subunit antibody
see all
Images
-
All lanes : Anti-DDB2 antibody (ab175409) at 1/500 dilution
Lane 1 : HeLa cell extract
Lane 2 : A431 cell extract
Predicted band size: 48 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney cancer tissue labelling DDB2 with ab175409 at 1/200. Magnification: 400x.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney cancer tissue labelling DDB2 with ab175409 at 1/200. Magnification: 200x.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling DDB2 with ab175409 at 1/200. Magnification: 200x.
-
Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab175409. Blue DAPI for nuclear staining.
-
Immunofluorescence analysis of U2OS cell using ab175409. Blue: DAPI for nuclear staining. DNA damage by a UV-A laser.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab175409 has not yet been referenced specifically in any publications.