Overview

  • Product name

    Anti-DDHD2 antibody
  • Description

    Rabbit polyclonal to DDHD2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DDHD2 aa 361-650.
    Sequence:

    LTNQKDSLGDIDSEKDSLNIVMDQGDTPTLEEDLKKLQLSEFFDIFEKEK VDKEALALCTDRDLQEIGIPLGPRKKILNYFSTRKNSMGIKRPAPQPASG ANIPKESEFCSSSNTRNGDYLDVGIGQVSVKYPRLIYKPEIFFAFGSPIG MFLTVRGLKRIDPNYRFPTCKGFFNIYHPFDPVAYRIEPMVVPGVEFEPM LIPHHKGRKRMHLELREGLTRMSMDLKNNLLGSLRMAWKSFTRAPYPALQ ASETPEETEAEPESTSEKPSDVNTEETSVAVKEEVLPINV


    Database link: O94830

  • Positive control

    • WB: K562 and U-251 MG whole cell lysates. IHC-P: Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 81 kDa.

Target

  • Function

    Phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine. May be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.
  • Tissue specificity

    Ubiquitously expressed (at protein level).
  • Sequence similarities

    Belongs to the PA-PLA1 family.
    Contains 1 DDHD domain.
    Contains 1 SAM (sterile alpha motif) domain.
    Contains 1 WWE domain.
  • Cellular localization

    Cytoplasm. Cytoplasmic granule.
  • Information by UniProt
  • Database links

  • Alternative names

    • DDHD domain containing protein 2 antibody
    • DDHD domain-containing protein 2 antibody
    • Ddhd2 antibody
    • DDHD2_HUMAN antibody
    • KIAA0725 antibody
    • mKIAA0725 antibody
    • Phospholipase DDHD2 antibody
    • SAM antibody
    • SAM, WWE and DDHD domain containing protein 1 antibody
    • SAMWD1 antibody
    • WWE and DDHD domain-containing protein 1 antibody
    see all

Images

  • All lanes : Anti-DDHD2 antibody (ab235832) at 1/500 dilution

    Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 81 kDa

  • Paraffin-embedded human small intestine tissue stained for DDHD2 using ab235832 at 1/100 dilution in immunohistochemical analysis.

References

ab235832 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up