Overview

  • Product name

  • Description

    Rabbit polyclonal to DDI2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Sheep, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human DDI2 aa 335-385. The exact sequence is proprietary. (NP_115717.3).
    Sequence:

    DLKKNVLVIGTTGSQTTFLPEGELPECARLAYGAGREDVRPEEIADQELA E


    Database link: Q5TDH0

  • Positive control

    • HeLa, 293T and Jurkat whole cell lysate (ab7899).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab197081 was affinity purified using an epitope specific to DDI2 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197081 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 45 kDa.

Target

Images

  • All lanes : Anti-DDI2 antibody (ab197081) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 45 kDa


    Exposure time: 3 minutes


    Lysates prepared using NETN lysis buffer.

  • Detection of DDI2 in immunoprecipitates of 293T whole cell lysates prepared using NETN lysis buffer (1 mg for IP, 20% of IP loaded) using ab197081 at 6 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

This product has been referenced in:

  • Nowak K  et al. Inhibition of calpain-1 stabilizes TCF11/Nrf1 but does not affect its activation in response to proteasome inhibition. Biosci Rep 38:N/A (2018). Read more (PubMed: 30177525) »
See 1 Publication for this product

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Cell lysate - whole cell (Bone Marrow Derived Macrophages)
Gel Running Conditions
Reduced Denaturing (8-18%)
Loading amount
150000 cells
Specification
Bone Marrow Derived Macrophages
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Feb 27 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up