Overview

  • Product name

  • Description

    Rabbit polyclonal to DDI2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human DDI2 aa 1-211.
    Sequence:

    MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYA ERPLTDNHRSLASYGLKDGDVVILRQKENADPRPPVQFPNLPRIDFSSIA VPGTSSPRQRQPPGTQQSHSSPGEITSSPQGLDNPALLRDMLLANPHELS LLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDL EAQAKIEEDIR


    Database link: Q5TDH0

  • Positive control

    • WB: A431, HL-60, K562 and Caco-2 whole cell lysates. IHC-P: Human endometrial cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 45 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-DDI2 antibody (ab235791) at 1/1000 dilution

    Lane 1 : A431 (human epidermoid carcinoma cell line) whole cell lysate
    Lane 2 : HL-60 (human promyelocytic leukemia cell line) whole cell lysate
    Lane 3 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 4 : Caco-2 (human colorectal adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 45 kDa

  • Paraffin-embedded human endometrial cancer tissue stained for DDI2 using ab235791 at 1/100 dilution in immunohistochemical analysis.

References

ab235791 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235791.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up