Overview

  • Product name

    Anti-DDIT4L/REDD2 antibody [DDIT-03] - N-terminal
    See all DDIT4L/REDD2 primary antibodies
  • Description

    Mouse monoclonal [DDIT-03] to DDIT4L/REDD2 - N-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human DDIT4L/REDD2 aa 2-98 (N terminal).
    Sequence:

    VATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEE STCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSST


    Database link: Q96D03

  • Positive control

    • DDIT4L/REDD2 transfected HEK293 cell lysate.
  • General notes

     This product was previously labelled as DDIT4L

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.097% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    ab191096 was purified from cell culture supernatant. Purity: > 95% (by SDS-PAGE).
  • Clonality

    Monoclonal
  • Clone number

    DDIT-03
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191096 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 22 kDa.
Flow Cyt Use at an assay dependent concentration.

Intracellular staining.

 

 

 

 

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

Images

  • All lanes : Anti-DDIT4L/REDD2 antibody [DDIT-03] - N-terminal (ab191096)

    Lane 1 : HEK293 transfected with DDIT4L plasmid
    Lane 2 : Untransfected HEK293

    Predicted band size: 22 kDa

References

ab191096 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191096.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up