Overview

  • Product name

    Anti-DDIT4L/REDD2 antibody [DDIT-03] (Phycoerythrin)
    See all DDIT4L/REDD2 primary antibodies
  • Description

    Mouse monoclonal [DDIT-03] to DDIT4L/REDD2 (Phycoerythrin)
  • Host species

    Mouse
  • Conjugation

    Phycoerythrin. Ex: 488nm, Em: 575nm
  • Tested applications

    Suitable for: Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human DDIT4L/REDD2 aa 2-98 (N terminal).
    Sequence:

    VATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEE STCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSST


    Database link: Q96D03

  • Positive control

    • Flow Cytometry: DDIT4L/REDD2-transfected HEK-293 cells .
  • General notes

     This product was previously labelled as DDIT4L

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C. Store In the Dark.
  • Storage buffer

    Preservative: 0.0975% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Size exclusion
  • Clonality

    Monoclonal
  • Clone number

    DDIT-03
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234255 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use at an assay dependent concentration.

Target

Images

  • Flow cytometry detection of DDIT4L/REDD2 in DDIT4L/REDD2-transfected HEK-293 (Human epithelial cell line from embryonic kidney) cells using ab234255. Gated on HEK-293 cells.

References

ab234255 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234255.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up