Anti-DDO antibody (ab232792)
Key features and details
- Rabbit polyclonal to DDO
- Suitable for: WB
- Reacts with: Cow, Human
- Isotype: IgG
Overview
-
Product name
Anti-DDO antibody
See all DDO primary antibodies -
Description
Rabbit polyclonal to DDO -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Cow, Human -
Immunogen
Recombinant fragment (His-tag) corresponding to Cow DDO aa 161-272. Expressed in E.coli.
Sequence:ILTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLKVQAPW VKHFIRDSSGLTYIYPGVSNVTLGGTRQKGDWNLSPDAEISKEILSRCCA LEPSLRGAYDLR
Database link: P31228 -
Positive control
- WB: Recombinant cow DDO; HepG2 cell lysate; Cow kidney lysate.
-
General notes
Previously labelled as D-aspartate oxidase.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab232792 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 38 kDa. |
Target
-
Function
Selectively catalyzes the oxidative deamination of D-aspartate and its N-methylated derivative, N-methyl D-aspartate. -
Sequence similarities
Belongs to the DAMOX/DASOX family. -
Cellular localization
Peroxisome. - Information by UniProt
-
Database links
- Entrez Gene: 280763 Cow
- Entrez Gene: 8528 Human
- Omim: 124450 Human
- SwissProt: P31228 Cow
- SwissProt: Q99489 Human
- Unigene: 591348 Human
-
Alternative names
- D aspartate oxidase antibody
- D-aspartate oxidase antibody
- DASOX antibody
see all
Images
-
Anti-DDO antibody (ab232792) at 2 µg/ml + Recombinant cow DDO
Predicted band size: 38 kDa -
Anti-DDO antibody (ab232792) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
Predicted band size: 38 kDa -
Anti-DDO antibody (ab232792) at 2 µg/ml + Cow kidney lysate
Predicted band size: 38 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab232792 has not yet been referenced specifically in any publications.