Overview

  • Product name

  • Description

    Rabbit polyclonal to DDX19A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human DDX19A aa 1-478.
    Sequence:

    MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEE EKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKP QLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGKTAAFVLA MLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGN KLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQ GHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREE ETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAA ELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQ VSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNI LNRIQEHFNKKIERLDTDDLDEIEKIAN


    Database link: Q9NUU7-1

  • Positive control

    • WB: Mouse gonad tissue lysate. IHC-P: Human ovarian cancer and prostate cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235531 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000.

Target

  • Function

    ATP-dependent RNA helicase involved in mRNA export from the nucleus.
  • Sequence similarities

    Belongs to the DEAD box helicase family. DDX19/DBP5 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization

    Cytoplasm. Nucleus > nuclear pore complex. Nucleus membrane. Nuclear pore complex cytoplasmic fibrils.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP dependent RNA helicase DDX19A antibody
    • ATP-dependent RNA helicase DDX19A antibody
    • DD19A_HUMAN antibody
    • DDX19 like protein antibody
    • DDX19-like protein antibody
    • DDX19A antibody
    • DDX19L antibody
    • DEAD box protein 19A antibody
    see all

Images

  • Paraffin-embedded human ovarian cancer tissue stained for DDX19A using ab235531 at 1/100 dilution in immunohistochemical analysis.

  • Anti-DDX19A antibody (ab235531) at 1/1000 dilution + Mouse gonad tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human prostate cancer tissue stained for DDX19A using ab235531 at 1/100 dilution in immunohistochemical analysis.

References

ab235531 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235531.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up