Overview

  • Product name

  • Description

    Rabbit polyclonal to DDX21
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DDX21 aa 699-783.
    Sequence:

    DSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQR EGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ


    Database link: Q9NR30

  • Positive control

    • IHC-P: Human appendix tissue. WB: Caco-2, HeLa, RT4 and U-251 MG cell lysates. ICC/IF U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244458 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 87 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Can unwind double-stranded RNA (helicase) and can fold or introduce a secondary structure to a single-stranded RNA (foldase). Functions as cofactor for JUN-activated transcription. Involved in rRNA processing.
  • Sequence similarities

    Belongs to the DEAD box helicase family. DDX21/DDX50 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Domain

    The two enzymatic activities reside in two separate domains, the helicase in the N-terminus and the foldase in the C-terminus.
    The 3 X 5 AA repeats seem to be critical for the RNA folding activity.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ddx21 antibody
    • DDX21_HUMAN antibody
    • DEAD (Asp-Glu-Ala-Asp) box helicase 21 antibody
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 antibody
    • DEAD box protein 21 antibody
    • EC 3.6.1.- antibody
    • Gu alpha antibody
    • Gu protein antibody
    • Gu-alpha antibody
    • GUA antibody
    • GURDB antibody
    • Nucleolar RNA helicase 2 antibody
    • Nucleolar RNA helicase Gu antibody
    • Nucleolar RNA helicase II antibody
    • RH II/Gu antibody
    • RH II/GuA antibody
    • RNA helicase II/Gu alpha antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for DDX21 (green) using ab244458 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human skeletal muscle tissue stained for DDX21 using ab244458 at 1/200 dilution in immunohistochemical analysis.
  • All lanes : Anti-DDX21 antibody (ab244458) at 0.4 µg/ml

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 87 kDa

  • All lanes : Anti-DDX21 antibody (ab244458) at 0.4 µg/ml

    Lane 1 : Caco-2 (human colorectal adenocarcinoma cell line) cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 87 kDa

  • Paraffin-embedded human appendix tissue stained for DDX21 using ab244458 at 1/200 dilution in immunohistochemical analysis.

References

ab244458 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244458.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up