Overview

  • Product name

  • Description

    Rabbit polyclonal to DDX26B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DDX26B aa 418-535.
    Sequence:

    DNLDCGLSYSVISYLKKLSQQTKLESERILASVGKKPPQEIGIKVKNHSG GGMSLTHNKNFRKLLKEITGETALRLTELNTKEFAGFQIGLLNKDLKPQT YRNAYDIPRRGLLDQLTRMRSNLLKTH


    Database link: Q5JSJ4

  • Positive control

    • IHC-P: Human small intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab246906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    The function of this protein remains unknown. There are 2 isoforms produced by alternative splicing.
  • Database links

  • Alternative names

    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 26B antibody
    • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26B antibody
    • FLJ41215 antibody
    • Integrator complex subunit 6 like antibody
    • Integrator complex subunit 6 like; protein DDX26B antibody
    • Protein DDX26B antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for DDX26B using ab246906 at 1/50 dilution in immunohistochemical analysis.

References

ab246906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up