Anti-DDX46 antibody (ab222039)

Submit a review Submit a question
Western blot - Anti-DDX46 antibody (ab222039)
  • Immunocytochemistry/ Immunofluorescence - Anti-DDX46 antibody (ab222039)

Key features and details

  • Rabbit polyclonal to DDX46
  • Suitable for: WB, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

Overview

  • Product name

    Anti-DDX46 antibody
    See all DDX46 primary antibodies

  • Description

    Rabbit polyclonal to DDX46

  • Host species

    Rabbit

  • Tested applications

    Suitable for: WB, ICC/IFmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan

  • Immunogen

    Recombinant fragment corresponding to Human DDX46 aa 576-671.
    Sequence:

    SKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIF VDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCK


    Database link: Q7L014
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: RT$ and U-251 MG whole cells lysates; ICC: U-251 MG whole cells.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), PBS
  • Concentration information loading...

  • Purity

    Immunogen affinity purified

  • Clonality

    Polyclonal

  • Isotype

    IgG

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 117 kDa.
ICC/IF Use a concentration of 0.25 - 2 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • Western blot - Anti-DDX46 antibody (ab222039)
    Western blot - Anti-DDX46 antibody (ab222039)
    All lanes : Anti-DDX46 antibody (ab222039) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) whole cell lysate
    Lane 2 : U-251 MG (formally U-373 MG) (Human brain glioma cell line) whole cell lysate

    Predicted band size: 117 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-DDX46 antibody (ab222039)
    Immunocytochemistry/ Immunofluorescence - Anti-DDX46 antibody (ab222039)

    Immunocytochemiscal analysis of U-251 MG (formally U-373 MG) (Human brain glioma cell line) whole cells labeling DDX46 (green) in the nuclear speckles with ab222039  at 2 µg/ml.

References (0)

Publishing research using ab222039? Please let us know so that we can cite the reference in this datasheet.

ab222039 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab222039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com