Anti-DDX46 antibody (ab222039)
Key features and details
- Rabbit polyclonal to DDX46
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DDX46 antibody
See all DDX46 primary antibodies -
Description
Rabbit polyclonal to DDX46 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Orangutan -
Immunogen
Recombinant fragment corresponding to Human DDX46 aa 576-671.
Sequence:SKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIF VDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCK
Database link: Q7L014 -
Positive control
- WB: RT$ and U-251 MG whole cells lysates; ICC: U-251 MG whole cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab222039 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 117 kDa. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Relevance
Plays an essential role in splicing, either prior to, or during splicing A complex formation. -
Cellular localization
Nucleus speckle. Nucleus, Cajal body. -
Database links
- Entrez Gene: 9879 Human
- Entrez Gene: 212880 Mouse
- Entrez Gene: 245957 Rat
- SwissProt: Q7L014 Human
- SwissProt: Q569Z5 Mouse
- SwissProt: Q62780 Rat
- Unigene: 406549 Human
- Unigene: 202725 Mouse
see all -
Alternative names
- DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 antibody
- DEAD box protein 46 antibody
- Probable ATP dependent RNA helicase DDX46 antibody
see all
Images
-
All lanes : Anti-DDX46 antibody (ab222039) at 0.4 µg/ml
Lane 1 : RT4 (Human urinary bladder cancer cell line) whole cell lysate
Lane 2 : U-251 MG (formally U-373 MG) (Human brain glioma cell line) whole cell lysate
Predicted band size: 117 kDa -
Immunocytochemiscal analysis of U-251 MG (formally U-373 MG) (Human brain glioma cell line) whole cells labeling DDX46 (green) in the nuclear speckles with ab222039 at 2 µg/ml.
Protocols
Datasheets and documents
References (0)
ab222039 has not yet been referenced specifically in any publications.